DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and HSD17B11

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_057329.3 Gene:HSD17B11 / 51170 HGNCID:22960 Length:300 Species:Homo sapiens


Alignment Length:270 Identity:67/270 - (24%)
Similarity:111/270 - (41%) Gaps:43/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGL-SRMHTLELDLLE 91
            :|||||...|:|. :..|....|...::  ..:|...|   |:..|:...|| :::||..:|...
Human    38 IVLITGAGHGIGR-LTAYEFAKLKSKLV--LWDINKHG---LEETAAKCKGLGAKVHTFVVDCSN 96

  Fly    92 PDSI----RLVHRQLRDILAKDPSYRLTALINNAGVMCFGEFEWQLTEQIEAQINCNLLGTMRLT 152
            .:.|    :.|..::.|:         :.|:|||||:...:.......|||.....|:|.....|
Human    97 REDIYSSAKKVKAEIGDV---------SILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTT 152

  Fly   153 HELLP-LLRQQQGRIINVTSHCGLQALPALGPYAASK-AALRF---WTDSLRVELQQYGMEVV-- 210
            ...|| :.:...|.|:.|.|..|..::|.|..|.:|| ||:.|   .||.| ..||..|::..  
Human   153 KAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDEL-AALQITGVKTTCL 216

  Fly   211 --NFIPGSFVLDSNIA----ARQQQHAQKMREAFSAEQHALYDTYFEAFNGYLKVLSGFKPPNRL 269
              ||:...|:.:.:.:    ...::...::......||..::.....||...|:         |:
Human   217 CPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLE---------RI 272

  Fly   270 RNESLLAKFK 279
            ..|..||..|
Human   273 LPERFLAVLK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 67/270 (25%)
adh_short 28..229 CDD:278532 57/218 (26%)
HSD17B11NP_057329.3 17beta-HSDXI-like_SDR_c 38..277 CDD:187598 64/263 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.