DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and MGC89248

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001004956.1 Gene:MGC89248 / 448371 XenbaseID:XB-GENE-5902365 Length:310 Species:Xenopus tropicalis


Alignment Length:311 Identity:90/311 - (28%)
Similarity:145/311 - (46%) Gaps:52/311 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGLSRMHTLELDLLEPD 93
            |||||||||.|:.:|...|.. .:.|::.|  :...||:.|:     |:..||:.|:.||:.:..
 Frog    33 VLITGCDSGFGNLLAKQLHRR-GVQVLAAC--LTQNGAEELK-----KETSSRLRTVILDVTDSQ 89

  Fly    94 SIRLVHRQLRDILAKDPSYRLTALINNAGVMC-FGEFEWQLTEQIEAQINCNLLGTMRLTHELLP 157
            |:....:.:..|: :|..  |..|:||||::. ....||...|.....|:.||||.:.:|..|||
 Frog    90 SVSATAKWVSHIV-QDQG--LWGLVNNAGILIPVTPNEWLKKEDFRTIIDVNLLGMVDVTLNLLP 151

  Fly   158 LLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGMEVVNFIPGSF---VL 219
            |:|:.:|||:||:|..|..|:.. |.|..||..:..::|:||.||:.:|:.|....|..|   :|
 Frog   152 LIRKAKGRIVNVSSIAGRVAICG-GGYCISKFGVEAFSDTLRRELRPFGVTVSIIAPDFFKTLIL 215

  Fly   220 DS--------NIAARQQQHAQKMREAFSAEQHALYDTYFEAFNGYLKVLSGFKPPNRLRNESLLA 276
            :|        ||.::..|:.          ::...|.||..:..|::.:.           ||..
 Frog   216 ESGRLLESIRNIWSKVPQNI----------KNHYGDQYFHKYCKYIEKMC-----------SLST 259

  Fly   277 KFKDALTSSQPLALYIEEP-RRY------RLYRWLFTLCPTPLVDWLTVRF 320
            .....:|.....||:...| .||      :||....:..||.:.|::...|
 Frog   260 SKLTLVTDCMEHALFAVHPWTRYSAGWYAKLYYMPLSYLPTCVADFVLRHF 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 84/289 (29%)
adh_short 28..229 CDD:278532 71/211 (34%)
MGC89248NP_001004956.1 NADB_Rossmann 31..307 CDD:389744 89/306 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.