DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and naz

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster


Alignment Length:181 Identity:50/181 - (27%)
Similarity:88/181 - (48%) Gaps:30/181 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RSLGLGRQ-----QLKVDSRHVVLITGCDSGLGHSMAVYCHESL---HMTVISCCHNIKS--EGA 66
            |:|..|::     |:|   ..:|::||.:||:|..:|    ::|   ...:|..|.|:::  ..|
  Fly    33 RTLMSGQRCPNDNQIK---EQIVVVTGGNSGIGFEIA----QALAGRGGRIILACRNLEAGKRAA 90

  Fly    67 KLLQGLASAKDGLSRM---------HTLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAG 122
            .:::.....:..|:.:         :.:|...|:..|:|.||.....::|:  ..|:..|:||||
  Fly    91 AIIKRELGCRTPLNSLDEDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAE--FERIDVLVNNAG 153

  Fly   123 VMCFGEFEWQLTEQIEAQINCNLLGTMRLTHELLP-LLRQQQGRIINVTSH 172
            |: |...:....:..|.....|.|....|||.||| |.|.:||||:.|::|
  Fly   154 VV-FANTQMPTEDGFERHSQVNYLAPFLLTHLLLPHLQRSEQGRILFVSAH 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 45/161 (28%)
adh_short 28..229 CDD:278532 45/160 (28%)
nazNP_001287387.1 FabG 47..318 CDD:223959 46/167 (28%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 45/161 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447514
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.