DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and dhrs9

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001001191.1 Gene:dhrs9 / 407852 XenbaseID:XB-GENE-973205 Length:322 Species:Xenopus tropicalis


Alignment Length:311 Identity:85/311 - (27%)
Similarity:142/311 - (45%) Gaps:29/311 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RQQLKVD--SRHVVLITGCDSGLG-HSMAVYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGL 79
            |..||::  :...:||||||:|.| |:...:..:...  :::.|  :...||   .||..|..  
 Frog    19 RDGLKINNITEKYILITGCDTGFGNHAAKTFDKQGFR--ILATC--LTEAGA---TGLREATS-- 74

  Fly    80 SRMHTLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVM-CFGEFEWQLTEQIEAQINC 143
            .|:.|..||:...:::..:...::..:.   |..|..|||||||| ....|:|...|.|:..:..
 Frog    75 QRLKTTLLDVTIAENVVSMAEWVKGEVG---SRGLWGLINNAGVMGTLAPFDWLTIEDIKKPMEI 136

  Fly   144 NLLGTMRLTHELLPLLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGME 208
            ||:|.:.:|..|||.:::.:||||||:|..|..|... |.|.:||..:..:.||||.:::.:|::
 Frog   137 NLIGLIHVTLVLLPFIKKAKGRIINVSSIGGRVAASG-GAYFSSKFGVEGFNDSLRRDMKAFGVQ 200

  Fly   209 VVNFIPGSFVLDSNIAARQQQHAQKMREAFSAEQHALY-DTYFEAFNGYLKVLSGFKPPNRLRNE 272
            |....||.|....:...:..|....:.:....|....| |.|.:     :......|...|:.|.
 Frog   201 VSCIEPGLFKTPLSDPKKVLQQRTDIWKRLPTEIQKEYGDNYIQ-----IDASKKQKLNQRILNT 260

  Fly   273 SL---LAKFKDALTSSQPLALYIEEPRRYRLYRWL-FTLCPTPLVDWLTVR 319
            .|   :...:.||||..|...|  .......:.|: .:..||.:.|::.:|
 Frog   261 DLSLVVQCMEHALTSRHPRTRY--SAGSDAAFLWIPLSYMPTFIQDFVILR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 77/278 (28%)
adh_short 28..229 CDD:278532 62/202 (31%)
dhrs9NP_001001191.1 type2_17beta_HSD-like_SDR_c 30..307 CDD:187665 81/296 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.