DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and CG8888

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster


Alignment Length:293 Identity:81/293 - (27%)
Similarity:139/293 - (47%) Gaps:26/293 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VLITGCDSGLGHSMAVYCHESLHMTVISCCHN--IKSEGAKLLQGLASAKDGLSRMHTLELDLLE 91
            ||||||::.|...:|... :.|..||.:..:.  .:|:.||:|:.:.|     .||..|.||:..
  Fly    98 VLITGCEAPLAWYLAKKL-DDLGFTVYAGFNTPIEESDEAKILKEVTS-----GRMKLLHLDVTS 156

  Fly    92 PDSIRLVHRQLRDILAKDPSYRLTALINNAGVMCFGEFEWQLTEQIEAQINCNLLGTMRLTHELL 156
            ..:|....|.:...|... :..|.::::.|..:..||.||.....:...::.||||:.|||...|
  Fly   157 EKTILEAARYVSQHLPHG-AEGLWSVVHCAHWIALGELEWIPFAVLRKSLDLNLLGSARLTQIFL 220

  Fly   157 PLLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGMEVV-----NFIPGS 216
            ||:|:..||::.:||.......|..|...|::||:..:...||.|::..|::|.     .|.||:
  Fly   221 PLVRRAHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGVDVSVVAAGEFAPGN 285

  Fly   217 FVLDSNIAARQQQHAQKMREAFSAEQHALY-DTYFEA----FNGYLKVLSGFKPPNRLRNESLLA 276
            ..|:.   ...:..|::|....|:||...| :.|:||    ...|.:..:..:|..|:..:::..
  Fly   286 GWLNE---TELRDQAKQMWNQLSSEQKKTYGEDYYEAAMTSVEKYSRQAADIQPTLRVLIDAVTR 347

  Fly   277 KFKDA----LTSSQPLALYIEEPRRYRLYRWLF 305
            .|..|    :|||:.|.:::.|.....||..|:
  Fly   348 TFPMARYTPVTSSERLQIFLAEHLAPSLYESLY 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 78/286 (27%)
adh_short 28..229 CDD:278532 59/206 (29%)
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 80/291 (27%)
adh_short 96..293 CDD:278532 59/204 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447498
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1610
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43313
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1882
SonicParanoid 1 1.000 - - X110
87.880

Return to query results.
Submit another query.