DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and Rdh7

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_598227.3 Gene:Rdh7 / 360420 RGDID:631370 Length:317 Species:Rattus norvegicus


Alignment Length:293 Identity:85/293 - (29%)
Similarity:143/293 - (48%) Gaps:32/293 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLRALRRSLGLGRQQLKVDSRHVVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQ 70
            |||..|....:...|.|     .|.|||||||.|:.:|... :...|.|::.|  :..:||:.|:
  Rat    14 LLRLFRERKVVSHLQDK-----YVFITGCDSGFGNLLARQL-DRRGMRVLAAC--LTEKGAEQLR 70

  Fly    71 GLASAKDGLSRMHTLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGV-MCFGEFEWQLT 134
            ...|     .|:.|:.||:.:.:||....:.:::.:.   :..|..|:||||: :..|..||...
  Rat    71 SKTS-----DRLETVILDVTKTESIVAATQWVKERVG---NRGLWGLVNNAGISVPMGPNEWMRK 127

  Fly   135 EQIEAQINCNLLGTMRLTHELLPLLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLR 199
            :...:.::.||||.:.:|..:|||:|:.:||::|:.|..|..:|.. |.|..||..:..::||||
  Rat   128 KDFASVLDVNLLGVIEVTLNMLPLVRKARGRVVNIASTMGRMSLLG-GGYCISKYGVEAFSDSLR 191

  Fly   200 VELQQYGMEVVNFIPGSFVLDSNIAARQQQHAQKMREAFSAEQHALY-----DTYFEAFNGYLKV 259
            .||..:|::|....||.|..:.....|...:.:|:.:..:.|...:|     |:|.:|....:.:
  Rat   192 RELTYFGVKVAIIEPGGFKTNVTNMERLSDNLKKLWDQATEEVKEIYGEKFRDSYMKAMESLVNM 256

  Fly   260 LSGFKPPNRLRNESLLAK-FKDALTSSQPLALY 291
            .||        :.||:.. .:.||||..|...|
  Rat   257 CSG--------DLSLVTDCMEHALTSCHPRTRY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 79/272 (29%)
adh_short 28..229 CDD:278532 63/201 (31%)
Rdh7NP_598227.3 type2_17beta_HSD-like_SDR_c 30..306 CDD:187665 80/277 (29%)
adh_short 30..214 CDD:278532 63/200 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 1 1.000 - - otm45084
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X110
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.