DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and CG30491

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster


Alignment Length:218 Identity:60/218 - (27%)
Similarity:91/218 - (41%) Gaps:43/218 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VVLITGCDSGLGHSMAVYCHESLHM------TVISCCHNIKSEGAKLLQGLASAKDGLSRMHTLE 86
            |.::||.::|:|       .|::..      ||...|.|:|.......:.:...|:  ..::..:
  Fly    47 VFIVTGANTGIG-------KETVREIAKRGGTVYMACRNLKKCEEAREEIVLETKN--KYVYCRQ 102

  Fly    87 LDLLEPDSIRLVHRQLRDILA-KDPSYRLTALINNAGVM-CFGEFEWQLT-EQIEAQINCNLLGT 148
            .||...:|||      ..:.| |.....|..|||||||| |    ...|| :.||.|:..|.:|.
  Fly   103 CDLASQESIR------HFVAAFKREQEHLHVLINNAGVMRC----PRSLTSDGIELQLGVNHMGH 157

  Fly   149 MRLTHELLPLLRQQQ-GRIINVTSHCGLQALPALG------------PYAASKAALRFWTDSLRV 200
            ..||:.||.||::.. .||:||:|....:.....|            .|:.||.|...:|..|..
  Fly   158 FLLTNLLLDLLKKSSPSRIVNVSSLAHTRGEINTGDLNSDKSYDEGKAYSQSKLANVLFTRELAK 222

  Fly   201 ELQQYGMEVVNFIPGSFVLDSNI 223
            .|:...:......||  |:|:.|
  Fly   223 RLEGTNVTANALHPG--VVDTEI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 60/218 (28%)
adh_short 28..229 CDD:278532 60/218 (28%)
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 60/218 (28%)
NADB_Rossmann 45..319 CDD:304358 60/218 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447509
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.