DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and CG13284

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001260523.1 Gene:CG13284 / 35021 FlyBaseID:FBgn0032614 Length:339 Species:Drosophila melanogaster


Alignment Length:289 Identity:59/289 - (20%)
Similarity:119/289 - (41%) Gaps:67/289 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LITGCDSGLGHSMA-VYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGLSRMHTLELDLLEPD 93
            ::||...|:|...| ....:.:::.:||          :..:.|.:..:.:...:.::...:..|
  Fly    74 VVTGATDGIGKEYARELARQGINLVLIS----------RTKEKLIAVTNEIESQYKVKTKWIAAD 128

  Fly    94 SIRLVHRQLRDILAKD-PSYRLTALINNAGVMCFGEFE-------------WQLTEQIEAQINCN 144
            ..:  .|::.|.:.|: ....:..|:||.|:|    :|             |.|       :..|
  Fly   129 FAK--GREVYDQIEKELAGIDVGILVNNVGMM----YEHPESLDLVSEDLLWNL-------LTVN 180

  Fly   145 LLGTMRLTHELLP-LLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGME 208
            :.....||.::|| ::.:::|.|:|:.|...||.||.:..|||||..:.:::.:|.:|:.::.:.
  Fly   181 MGSVTMLTRKILPQMIGRRKGAIVNLGSSSELQPLPNMTVYAASKKFVTYFSKALELEVAEHNIH 245

  Fly   209 VVNFIPGSFVLDSN-IAARQQQHAQKMREAFSAEQHALY------DTYFEAFNGY---------- 256
            |...:|...|...| ...|..|.......|::..:.|::      :|     ||:          
  Fly   246 VQLVMPNFVVTKMNAYTDRVMQGGLFFPNAYTFARSAVFTLGKTSET-----NGFWTHGIQYAIM 305

  Fly   257 ------LKVLSGFKPPNRLRNESLLAKFK 279
                  ::...|.:...|||.|:|..|.|
  Fly   306 KLAPLPIRTYLGHQLFKRLRIEALEQKQK 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 59/289 (20%)
adh_short 28..229 CDD:278532 45/215 (21%)
CG13284NP_001260523.1 DltE 70..323 CDD:223377 52/276 (19%)
17beta-HSD1_like_SDR_c 70..309 CDD:187614 51/262 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447506
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.