DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and firl

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001033900.2 Gene:firl / 34627 FlyBaseID:FBgn0032405 Length:318 Species:Drosophila melanogaster


Alignment Length:191 Identity:57/191 - (29%)
Similarity:97/191 - (50%) Gaps:13/191 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LGRQQLKVDSRHVVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQGLASAKD-GL 79
            |.::|..| |..:|||||...|:|..:|:: :.||..||:  |.:|  :|...||.:..||. .|
  Fly    46 LPKKQKDV-SGEIVLITGTGHGIGRELALH-YASLGSTVV--CVDI--DGKNNLQTVEKAKRLNL 104

  Fly    80 SRMHTLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVMCFGEFEWQLTEQIEAQINCN 144
            ..:::...|:.:.|.:    ..|.|.:..|... ::.|:||.|:|.......|..|:|:...:.|
  Fly   105 GEVYSYSCDVSKRDEV----TALADRIKSDVGC-ISVLVNNVGIMPTHPILQQSAEEIQRVFDVN 164

  Fly   145 LLGTMRLTHELLPLLRQQ-QGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQ 204
            :..........||.:::: :|.||.::|..||..:..|.||.|:|.|:|...::|..||:|
  Fly   165 VFSQFWTIQAFLPHMQEKCRGHIICMSSIAGLVGISNLVPYCATKFAVRGLMEALHAELRQ 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 53/180 (29%)
adh_short 28..229 CDD:278532 53/179 (30%)
firlNP_001033900.2 adh_short 56..246 CDD:278532 53/180 (29%)
17beta-HSDXI-like_SDR_c 57..299 CDD:187598 53/179 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447501
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.