DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and CG15629

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_608859.1 Gene:CG15629 / 33679 FlyBaseID:FBgn0031630 Length:325 Species:Drosophila melanogaster


Alignment Length:194 Identity:54/194 - (27%)
Similarity:89/194 - (45%) Gaps:12/194 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QQLKVDSRHVVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGLSRMH 83
            ::||..|..||||||...|:|..:|:.........||   .:|..|..|....|. ||.|.....
  Fly    49 RKLKDISGQVVLITGGGGGVGRLIALNFARLQARIVI---WDINQEAIKTTVDLL-AKHGYDNCK 109

  Fly    84 TLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVMCFGEFEWQLTEQ-IEAQINCNLLG 147
            ...:|:.:.:.|.....|:.:.:..     :..||||||::|...| |:|.:: |:...|.|::.
  Fly   110 GYVVDISDREQIYQRASQVTEEVGP-----VDILINNAGIVCCKPF-WELHDRVIQNTYNINIIS 168

  Fly   148 TMRLTHELLP-LLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGMEVV 210
            ........|| ::|..:|.|:.|.|..|:........|||:|.|...:.:||..:|:.:|.:.:
  Fly   169 HYWTVKAFLPHMMRNNRGHIVTVGSVTGMLGTYGCSDYAATKYACIGFHESLLTDLKAHGYDQI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 51/186 (27%)
adh_short 28..229 CDD:278532 51/185 (28%)
CG15629NP_608859.1 17beta-HSDXI-like_SDR_c 58..298 CDD:187598 51/185 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447497
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.