Sequence 1: | NP_651725.1 | Gene: | sro / 43512 | FlyBaseID: | FBgn0262112 | Length: | 335 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001285318.1 | Gene: | Mfe2 / 32582 | FlyBaseID: | FBgn0030731 | Length: | 598 | Species: | Drosophila melanogaster |
Alignment Length: | 206 | Identity: | 45/206 - (21%) |
---|---|---|---|
Similarity: | 80/206 - (38%) | Gaps: | 52/206 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 QLKVDSRHVVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKL----LQGLASAKDGLS 80
Fly 81 RMHTLELDLLEP-------------DSIRLVHRQLRDILAKDPSYRLTALINNAGVM------CF 126
Fly 127 GEFEWQLTEQIEAQINCNLLGTMRLTHELLPLLRQQQ-GRIINVTSHCGLQALPALGPYAASKAA 190
Fly 191 LRFWTDSLRVE 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sro | NP_651725.1 | 17beta-HSD-like_SDR_c | 27..300 | CDD:187632 | 42/199 (21%) |
adh_short | 28..229 | CDD:278532 | 42/198 (21%) | ||
Mfe2 | NP_001285318.1 | hydroxyacyl-CoA-like_DH_SDR_c-like | 8..257 | CDD:187611 | 45/205 (22%) |
PRK07791 | 11..248 | CDD:236099 | 44/202 (22%) | ||
PLN02864 | 315..598 | CDD:178455 | |||
hot_dog | <383..442 | CDD:294345 | |||
HDE_HSD | 471..592 | CDD:239532 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45447503 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |