DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and Mfe2

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001285318.1 Gene:Mfe2 / 32582 FlyBaseID:FBgn0030731 Length:598 Species:Drosophila melanogaster


Alignment Length:206 Identity:45/206 - (21%)
Similarity:80/206 - (38%) Gaps:52/206 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QLKVDSRHVVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKL----LQGLASAKDGLS 80
            :|:.|.| |.::||..:|||...|:...|               .|||:    |.|..|......
  Fly     7 KLRYDGR-VAVVTGAGAGLGREYALLFAE---------------RGAKVVVNDLGGTHSGDGASQ 55

  Fly    81 RMHTLELDLLEP-------------DSIRLVHRQLRDILAKDPSYRLTALINNAGVM------CF 126
            |...:.:|.:..             |..:::...::..      .|:..|:||||::      ..
  Fly    56 RAADIVVDEIRKAGGEAVADYNSVIDGAKVIETAIKAF------GRVDILVNNAGILRDRSLVKT 114

  Fly   127 GEFEWQLTEQIEAQINCNLLGTMRLTHELLPLLRQQQ-GRIINVTSHCGLQALPALGPYAASKAA 190
            .|.:|.|...:      :|.|:.:.|....|.:::|. ||||..:|:.|:........|.|:|..
  Fly   115 SEQDWNLVNDV------HLKGSFKCTQAAFPYMKKQNYGRIIMTSSNSGIYGNFGQVNYTAAKMG 173

  Fly   191 LRFWTDSLRVE 201
            |....:::.:|
  Fly   174 LIGLANTVAIE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 42/199 (21%)
adh_short 28..229 CDD:278532 42/198 (21%)
Mfe2NP_001285318.1 hydroxyacyl-CoA-like_DH_SDR_c-like 8..257 CDD:187611 45/205 (22%)
PRK07791 11..248 CDD:236099 44/202 (22%)
PLN02864 315..598 CDD:178455
hot_dog <383..442 CDD:294345
HDE_HSD 471..592 CDD:239532
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447503
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.