DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and dhrs9

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_955903.1 Gene:dhrs9 / 322529 ZFINID:ZDB-GENE-030131-1249 Length:319 Species:Danio rerio


Alignment Length:326 Identity:87/326 - (26%)
Similarity:149/326 - (45%) Gaps:49/326 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LGRQQLKVDSRHVVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGLS 80
            |||...|  |...|.|||||:|.|:.:|.:. ::....||:.|::.|.|..  |:.:.|     .
Zfish    21 LGRVSNK--SEKFVYITGCDTGFGNLLARHL-DTKGFRVIAGCYSEKGEDE--LKKICS-----D 75

  Fly    81 RMHTLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVMCF--GEFEWQLTEQIEAQINC 143
            |:.||.||:.:.::::.....::.::.:.   .|.|::||||: .|  ...:|...|.....||.
Zfish    76 RLITLHLDVTDNENVKKAAETIKSLVGQK---GLWAVVNNAGI-AFPTAPNDWLEIEDFTPMINV 136

  Fly   144 NLLGTMRLTHELLPLLRQQQGRIINVTSHCG-LQALPALGPYAASKAALRFWTDSLRVELQQYGM 207
            ||:|.:.:|..:|||:::.:||::||.|..| :..|.  |.|..:|..:..:.|:||.::..:|:
Zfish   137 NLIGVIAVTLSVLPLIKKAKGRVVNVASVFGRISTLG--GAYCITKYGVEAFNDALRRQMAPFGV 199

  Fly   208 EVVNFIPGSF---VLDSNIAARQQQHAQKMREAFSAEQHALYDTYFEAFNGYLKVLSGFKPPNRL 269
            :|:...||.|   |.|.||.      ...:...::.....:.|.|.          |.:....:|
Zfish   200 KVLCIEPGFFKTIVTDFNIV------ESTLHRLWNKLPQEVKDEYG----------SDYVDKTKL 248

  Fly   270 RNESLLAKFKDA----LTSSQPLALYIEEPR-RY-----RLYRWL-FTLCPTPLVDWLTVRFCAM 323
            ..:.||.|..|.    :.|....|:....|| ||     ..:.|| .:..||.:.|.|.::....
Zfish   249 TAKELLEKLADGDLMKVVSCMEHAVAAVHPRTRYSPGWDAKFFWLPLSYMPTFISDALLLKKAVQ 313

  Fly   324 P 324
            |
Zfish   314 P 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 75/288 (26%)
adh_short 28..229 CDD:278532 61/206 (30%)
dhrs9NP_955903.1 NADB_Rossmann 30..307 CDD:304358 80/306 (26%)
adh_short 30..211 CDD:278532 57/194 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1610
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X110
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.