DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and CG31810

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster


Alignment Length:296 Identity:54/296 - (18%)
Similarity:120/296 - (40%) Gaps:80/296 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LITGCDSGLGHSMA-VYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGLSRMHTLELDLLEPD 93
            ::||...|:|...| ....:.|::.::|     :.|     :.|.:..:.:...:.:::..:..|
  Fly    60 VVTGATDGIGKEYARELARQGLNLVLVS-----RKE-----EKLIAVTNEIGSQYNVKIKWIVAD 114

  Fly    94 SIR------LVHRQLRDILAKDPSYRLTALINNAGVM--------CFGEFEWQLTEQIEAQINCN 144
            ..:      .:.::|..|       .:..|:||.|.:        ...:..|.|       :..|
  Fly   115 FAKGREVYAHIEKELNGI-------EVGILVNNVGTIHDPESLDKVSEDMLWDL-------LTVN 165

  Fly   145 LLGTMRLTHELLP-LLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGME 208
            :.....||.::|| ::.:::|.|:|:.|...||..|.|..|||:|..:..:|..|..|:.::.:.
  Fly   166 VGSVTMLTRKILPQMISRRKGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIH 230

  Fly   209 VVNFIPGSFVLDSNIAARQQQHAQKMRE-------AFSAEQHALY------DTYFEAFNGY---- 256
            |      ..|:.:.:|.....::.|:|:       |:|..:.|::      :|     ||:    
  Fly   231 V------QLVMPAFVATNMNSYSDKVRQGGLLFPNAYSYARSAVFTLGKTSET-----NGFWVHG 284

  Fly   257 ------------LKVLSGFKPPNRLRNESLLAKFKD 280
                        ::...|::...|:|.|::..:.|:
  Fly   285 LQYAFMKLAPMDIRTYFGYQLFKRMRIEAMEHRLKN 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 54/296 (18%)
adh_short 28..229 CDD:278532 41/214 (19%)
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 51/284 (18%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 49/271 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447504
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.