DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and CG31809

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster


Alignment Length:240 Identity:46/240 - (19%)
Similarity:101/240 - (42%) Gaps:53/240 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LITGCDSGLGHSMA-VYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGLSRMHTLELDLLEPD 93
            ::||...|:|...| ....:.|::.::|     :.|     :.|.:..:.:...:.:::..:..|
  Fly    52 VVTGATDGIGKEYARELARQGLNLVLVS-----RKE-----EKLIAVTNEIGSQYNVKIKWIVAD 106

  Fly    94 SIR------LVHRQLRDILAKDPSYRLTALINNAGVM--------CFGEFEWQLTEQIEAQINCN 144
            ..:      .:.::|..|       .:..|:||.|.:        ...:..|.|       :..|
  Fly   107 FAKGREVYAHIEKELNGI-------EVGILVNNVGTIHDPESLDKVSEDMLWDL-------LTVN 157

  Fly   145 LLGTMRLTHELLP-LLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGME 208
            :.....||.::|| ::.:::|.|:|:.|...||..|.|..|||:|..:..:|..|..|:.::.:.
  Fly   158 VGSVTMLTRKILPQMISRRKGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIH 222

  Fly   209 VVNFIPGSFVLDSNIAARQQQHAQKMRE-------AFSAEQHALY 246
            |      ..|:.:.:|.....::.|:|:       |:|..:.|::
  Fly   223 V------QLVMPAFVATNMNSYSDKVRQGGLLFPNAYSYARSAVF 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 46/240 (19%)
adh_short 28..229 CDD:278532 41/214 (19%)
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 46/240 (19%)
DltE 50..302 CDD:223377 46/240 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447505
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.