DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and CG3842

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster


Alignment Length:340 Identity:85/340 - (25%)
Similarity:126/340 - (37%) Gaps:79/340 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RQQLKVDSRHVVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGLSRM 82
            |:..::|.: ||::|||::|:|....:...:......::|....:.|.|:|        |.:.|.
  Fly    67 RKANRIDGK-VVIVTGCNTGIGKETVLELAKRGARVYMACRDPGRCEAARL--------DIMDRS 122

  Fly    83 HTLE-----LDLLEPDSIR-LVHRQLRDILAKDPSYRLTALINNAGVMCFGEFEWQLT-EQIEAQ 140
            ...:     |||....|:| .|.|      .|....||..||||||||....   .|| :..|.|
  Fly   123 RNQQLFNRTLDLGSLQSVRNFVER------FKAEESRLDILINNAGVMACPR---TLTADGFEQQ 178

  Fly   141 INCNLLGTMRLTHELLPLLRQQQ-GRIINVTSHCGL------QALPA-------LGPYAASKAAL 191
            ...|.||...||:.||..|:... .||:.|:|...|      :.|.:       .|.|:.||.|.
  Fly   179 FGVNHLGHFLLTNLLLDRLKHSSPSRIVVVSSAAHLFGRINREDLMSEKNYSKFFGAYSQSKLAN 243

  Fly   192 RFWTDSLRVELQQYGMEVVNFIPGSFVLDSNIAARQQQHAQKMREAFSAEQHALYDTYFEAFNGY 256
            ..:|..|...|:..|:.|....||....:.|      :|       ||..             |:
  Fly   244 ILFTLKLSTILKDTGVTVNCCHPGVVRTEIN------RH-------FSGP-------------GW 282

  Fly   257 LKV------LSGFKPPNRLRNESLLAKFKDALTSSQPLALYIEEPRRYRLYRWLFTLCPTPLVDW 315
            :|.      |..||.|.......|.......|..|  ...|..:..|:.|:.|:..:   ...||
  Fly   283 MKTALQKGSLYFFKTPKAGAQTQLRLALDPQLEGS--TGGYYSDCMRWPLFPWVRNM---QTADW 342

  Fly   316 L---TVRFCAMPTYE 327
            |   :.:...:|..|
  Fly   343 LWRESEKLLGLPPLE 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 76/299 (25%)
adh_short 28..229 CDD:278532 62/221 (28%)
CG3842NP_001259270.1 FabG 71..319 CDD:223959 75/293 (26%)
NADB_Rossmann 74..347 CDD:304358 81/321 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447513
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.