DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and CG13377

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001259089.1 Gene:CG13377 / 30972 FlyBaseID:FBgn0261446 Length:330 Species:Drosophila melanogaster


Alignment Length:207 Identity:51/207 - (24%)
Similarity:86/207 - (41%) Gaps:40/207 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGL------------- 79
            |||||..|:.||               :..|.::.::|.::..|:..|:|.|             
  Fly    47 VVLITSADTALG---------------LQLCTHLANKGYRVFAGMKEAQDSLPAKLLCGWMKIRE 96

  Fly    80 -------SRMHTLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVMCFGEFEWQLTEQI 137
                   ..:..:.||:...|.:|.....:...|..| ...:.|:||.:|.:..|:.|.|..:|.
  Fly    97 YSEEPIAGTIIPMRLDVTREDVLREATVIIGANLNAD-ERGIAAVINTSGSVFRGQVESQNVQQW 160

  Fly   138 EAQINCNLLGTMRLTHELLPLLRQQQGRIINVTSHCG----LQALPALGPYAASKAALRFWTDSL 198
            |..:..|:|||:|:....:..||..:||::.:....|    ......|..:.||:.|:....:.|
  Fly   161 EHMLRTNILGTLRVAKAFVCFLRPTRGRLLYLGGVSGGGNARNEGDGLVAFNASRVAVDKCAEEL 225

  Fly   199 RVELQQYGMEVV 210
            |.||..||:.||
  Fly   226 RKELHPYGVSVV 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 51/207 (25%)
adh_short 28..229 CDD:278532 51/207 (25%)
CG13377NP_001259089.1 adh_short 46..246 CDD:278532 51/207 (25%)
NADB_Rossmann 46..>237 CDD:304358 49/205 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1610
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.