DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and Rdh16

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_954678.1 Gene:Rdh16 / 299511 RGDID:735050 Length:317 Species:Rattus norvegicus


Alignment Length:326 Identity:95/326 - (29%)
Similarity:149/326 - (45%) Gaps:49/326 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLRALRRSLGLGRQQLKVDSRHVVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQ 70
            |||..|....:...|.|     .|.|||||||.|:.:|... :...|.|::.|  :..:||:.|:
  Rat    14 LLRLFRERKVVSHLQDK-----YVFITGCDSGFGNLLARQL-DRRGMRVLAAC--LTEKGAEQLR 70

  Fly    71 GLASAKDGLSRMHTLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVM-CFGEFEWQLT 134
            ...|     .|:.|:.||:.:.:||....:.:::.:.   :..|..|:||||:. ..|..||...
  Rat    71 SKTS-----DRLETVILDVTKTESIVAATQWVKERVG---NTGLWGLVNNAGISGHLGPNEWMNK 127

  Fly   135 EQIEAQINCNLLGTMRLTHELLPLLRQQQGRIINVT------SHCGLQALPALGPYAASKAALRF 193
            :.|.:.::.||||.:.:|...:||:|:.:||::||.      |.||       |.|..||..:..
  Rat   128 QNIASVLDVNLLGMIEVTLSTVPLVRKARGRVVNVASIAGRLSFCG-------GGYCISKYGVEA 185

  Fly   194 WTDSLRVELQQYGMEVVNFIPGSFVLDSNIAARQQQHAQKMREAFSAEQHALYDTYFEAFNGYLK 258
            ::||||.||..:|::|....||.|..|.........:.|.:.:..|:|...:|...:.|  .|||
  Rat   186 FSDSLRRELSYFGVKVAIVEPGFFRTDVTNGVTLSSNFQMLWDQTSSEVREVYGENYLA--SYLK 248

  Fly   259 VLSGFKPPNRLRNESLLAK--FKDALTSSQPLALYIEEPRRY------RLYRWLFTLCPTPLVDW 315
            :|:|.  ..|...:..|..  .:.||||..|..       ||      :.:....:..||.|||.
  Rat   249 MLNGL--DQRCNKDLSLVTDCMEHALTSCHPRT-------RYSAGWDAKFFYLPMSYLPTFLVDA 304

  Fly   316 L 316
            |
  Rat   305 L 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 83/287 (29%)
adh_short 28..229 CDD:278532 64/207 (31%)
Rdh16NP_954678.1 type2_17beta_HSD-like_SDR_c 30..305 CDD:187665 89/308 (29%)
adh_short 30..214 CDD:278532 65/206 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 1 1.000 - - otm45084
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X110
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.