DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and Dhrs7l1

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001013116.1 Gene:Dhrs7l1 / 299131 RGDID:1308036 Length:324 Species:Rattus norvegicus


Alignment Length:323 Identity:92/323 - (28%)
Similarity:129/323 - (39%) Gaps:62/323 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLRALRRSLGLGRQQLKVDSRHVVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAK--- 67
            ||||  ..:|...:|...|.  ||.|||..||:|..:|....:.....|:|.....:.|..|   
  Rat    33 LLRA--AWMGQCPEQALADK--VVWITGASSGIGEELAFQLSKLGVCLVLSARRGQELERVKRRC 93

  Fly    68 LLQGLASAKDGLSRMHTLELDLLEPDSIRLVHRQLRDILAK---DPSYRLTALINNAGVMCFGEF 129
            |..|....||.|    .|.|||.:..|        .||..|   ....|:..|:||.||......
  Rat    94 LENGNLKEKDIL----VLPLDLADTSS--------HDIATKTVLQEFGRIDILVNNGGVAHASLV 146

  Fly   130 EWQLTEQIEAQINCNLLGTMRLTHELLP-LLRQQQGRIINVTSHCGLQALPALGPYAASKAALRF 193
            |....:..:..|..|.|||:.||..:|| ::.:.||:|:.:.|..|:...|....|||||.|||.
  Rat   147 ENTNMDIFKVLIEVNYLGTVSLTKCVLPHMMERNQGKIVVMKSLVGIVPRPLCSGYAASKLALRG 211

  Fly   194 WTDSLRVELQQY-GMEVVNFIPGSFVLDSNIAARQQQHAQKMREAFSAEQHALYDTYFEAFNGYL 257
            :.|.||.||..| |:.:....||..            |:...:.||:.:       :.|.   .|
  Rat   212 FFDVLRTELFDYPGITLSMICPGPV------------HSNIFQNAFTGD-------FTET---RL 254

  Fly   258 KVLSGFKPPN----RLRNESLLAKFKDALTSSQPLALYIEEPRRYRLYRWLFTLCPTPLVDWL 316
            ..:..||...    :|...||....:|...::||:.|        |.|.|.:    .|..||:
  Rat   255 PKIPLFKMETSRCVQLILVSLANDLEDIWIANQPVLL--------RAYVWQY----VPFRDWI 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 79/284 (28%)
adh_short 28..229 CDD:278532 65/208 (31%)
Dhrs7l1NP_001013116.1 11beta-HSD1_like_SDR_c 47..305 CDD:187593 85/305 (28%)
adh_short 50..247 CDD:278532 68/222 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.