DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and Dhrs7b

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001008507.1 Gene:Dhrs7b / 287380 RGDID:1311243 Length:325 Species:Rattus norvegicus


Alignment Length:282 Identity:69/282 - (24%)
Similarity:120/282 - (42%) Gaps:40/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLRALRRSLGLGRQQLKVDSRH-VVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLL 69
            |.|.|:|:      :.|...|: ||::||..||||...|...| :....|:.|..|:|:. .:..
  Rat    37 LFRLLQRT------RSKAYLRNAVVVVTGATSGLGKECARVFH-AAGAKVVLCGRNVKAL-EEFT 93

  Fly    70 QGLASAKDGLSRMH---TLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVMCFGEFEW 131
            :.||.:.....:.|   .:..||.:|.:|.....::.....     .:..||||||:...|....
  Rat    94 RELADSSSSQGQTHQPCVVTFDLADPGAIAPAAAEILQCFG-----YVDILINNAGISYRGAISD 153

  Fly   132 QLTEQIEAQINCNLLGTMRLTHELLP-LLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWT 195
            .:.:.....:..|..|.:.||..||| ::.:::|.|:.::|..|..::|....|||||.|.:.:.
  Rat   154 TIVDVDRKVMEINYFGPVALTKALLPSMVERKRGHIVAISSIQGKISIPFRSAYAASKHATQAFF 218

  Fly   196 DSLRVELQQYGMEVVNFIPGSF-----------------VLDSNIAARQQQHAQKMREAFSA--- 240
            |.||.|::...:||....||..                 .||.| .|:.:...:..::.|.|   
  Rat   219 DCLRAEMKDSDIEVTVISPGYIHTNLSVNAVTADGSRYGALDKN-TAQGRSAVEVAQDIFDAVGK 282

  Fly   241 -EQHALYDTYFEAFNGYLKVLS 261
             ::..|...:......|::.|:
  Rat   283 KKKDVLLTDFLPTMAVYIRTLA 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 63/261 (24%)
adh_short 28..229 CDD:278532 58/221 (26%)
Dhrs7bNP_001008507.1 11beta-HSD1_like_SDR_c 50..311 CDD:187593 64/263 (24%)
PRK06181 52..321 CDD:235726 63/261 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.