DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and Sdr9c7

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_006241577.1 Gene:Sdr9c7 / 259235 RGDID:628716 Length:313 Species:Rattus norvegicus


Alignment Length:318 Identity:95/318 - (29%)
Similarity:152/318 - (47%) Gaps:50/318 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SRHVVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGA-KLLQGLASAKDGLSRMHTLELD 88
            |...|.|||||||.|:.:|....:. .|.|::.|  :..||| ||||      |...::....||
  Rat    24 SEKYVFITGCDSGFGNLLARQLVDR-GMKVLAAC--LTEEGAQKLLQ------DTSYQLQIFLLD 79

  Fly    89 LLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGV-MCFGEFEWQLTEQIEAQINCNLLGTMRLT 152
            :.:.:|::...:.:||.:.:.   .|.||:||||| :..|..||...|.....||.||:|.:.:|
  Rat    80 VTKSESVKAAAQWVRDQVGEQ---GLWALVNNAGVGLPSGPNEWLTKEDFVKVININLVGLIDVT 141

  Fly   153 HELLPLLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGMEVVNFIPGSF 217
            ..:||:|::.:||::|::|..|..|:.. |.|..||..:..::||:|.||..:|::|....||::
  Rat   142 LNMLPMLKKARGRVVNMSSSGGRVAVIG-GGYCVSKFGVEAFSDSIRRELHFFGVKVSIIEPGNY 205

  Fly   218 --------VLDSNIAARQQQHAQKMREAFSAEQHALYDTYFEAFNGYLKVLSGFKPPNRLRNESL 274
                    .|.|.:.....:..|:.|:::..|       ||:.:...|..|.....|        
  Rat   206 KTSILGQEALQSRMRKLWDRLPQETRDSYGEE-------YFQTYTDKLVNLMRTAEP-------- 255

  Fly   275 LAKFKDALTSSQPLALYIEEPR-RYR-------LYRWLFTLCPTPLVDWLTVRFCAMP 324
              :..| :|:|...|:....|| ||.       ||..|..| |||:.|::..|:...|
  Rat   256 --RISD-VTNSMEHAIVSRSPRIRYNPGLDVKLLYIPLSKL-PTPVTDFILSRYLPKP 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 84/290 (29%)
adh_short 28..229 CDD:278532 68/210 (32%)
Sdr9c7XP_006241577.1 type2_17beta_HSD-like_SDR_c 26..302 CDD:187665 92/307 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1610
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 1 1.000 - - otm45084
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X110
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.