DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and SPCC162.03

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_588241.1 Gene:SPCC162.03 / 2539382 PomBaseID:SPCC162.03 Length:292 Species:Schizosaccharomyces pombe


Alignment Length:233 Identity:66/233 - (28%)
Similarity:106/233 - (45%) Gaps:31/233 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VLITGCDSGLGHSMAVYCHESLHMTVISCCH---NIKSEGAKLLQGLASAKDGLSRMHTLELDLL 90
            |||||...|||::: |....:....||:|..   .|..|.:|||:              |:||:.
pombe     8 VLITGSSKGLGYAL-VKVGLAQGYNVIACSRAPDTITIEHSKLLK--------------LKLDVT 57

  Fly    91 EPDSIRLVHRQLRDILAKDPSYRLTALINNAGVMCFGEFEWQLTEQIEAQINCNLLGTMRLTHEL 155
            :..|:....:.     ||.....:..:|||||....||||....|::..|:|.|..|...:|.|.
pombe    58 DVKSVETAFKD-----AKRRFGNVDIVINNAGYGLVGEFESYNIEEMHRQMNVNFWGVAYITKEA 117

  Fly   156 LPLLRQ--QQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQ-QYGMEVVNFIPGSF 217
            |.|:|:  :.|||:.::|..|....|.|..|.|||.|:...:.::..||. .:.:.:....||. 
pombe   118 LNLMRESGKGGRILQISSVAGYYPSPCLSMYNASKFAVEGLSQTIMRELDPNWNIAITIVQPGG- 181

  Fly   218 VLDSNIAARQQQHAQKMREAFSAEQHALYDTYFEAFNG 255
             :.:..|:...|.| |...|:  |....:..::|.::|
pombe   182 -MQTEWASSNMQWA-KPHPAY--ENDRSWRPFWENYHG 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 66/233 (28%)
adh_short 28..229 CDD:278532 59/205 (29%)
SPCC162.03NP_588241.1 17beta-HSD-like_SDR_c 7..248 CDD:187632 66/233 (28%)
PRK08263 9..257 CDD:181334 65/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.