DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and Hsd11b2

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_058777.1 Gene:Hsd11b2 / 25117 RGDID:2835 Length:400 Species:Rattus norvegicus


Alignment Length:338 Identity:96/338 - (28%)
Similarity:140/338 - (41%) Gaps:71/338 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLRALRRSLGLGR-------------------------------------------QQLKVDSRH 27
            ||:.||..|.|||                                           .:|.|.:| 
  Rat    20 LLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALVVLAGAGWIALSRLARPPRLPVATR- 83

  Fly    28 VVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGLSRMHTLELDLLEP 92
            .|||||||:|.|...|... :::..||::...::...||..|:...|     .|:..|::||.:|
  Rat    84 AVLITGCDTGFGKETAKKL-DAMGFTVLATVLDLNGPGALELRARCS-----PRLKLLQMDLTKP 142

  Fly    93 DSIRLVHRQLRDILAKDPSYRLTALINNAGV-MCFGEFEWQLTEQIEAQINCNLLGTMRLTHELL 156
            :.|   .|.|....|...|..|..|:||||: |...:.|..........:..|..|.:.||..||
  Rat   143 EDI---SRVLEITKAHTASTGLWGLVNNAGLNMVVADVELSPVVTFRECMEVNFFGALELTKGLL 204

  Fly   157 PLLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGMEVVNFIPGSF---- 217
            ||||..:|||:.|.|..|....|.|..|..||||:....|:...||..:|::|....||.|    
  Rat   205 PLLRHSRGRIVTVGSPAGDMPYPCLAAYGTSKAAIALLMDTFSCELLPWGIKVSIIQPGCFKTEA 269

  Fly   218 VLDSNIAARQQQ--HAQKMREAFSAEQHALY-DTYFEAFNG-YLKVLSGFKPPNRLRNESLLAKF 278
            |.:.|:..:::|  .|...||...|     | :.|.|..:| :|..|....|......::::   
  Rat   270 VTNVNLWEKRKQLLLANLPRELLQA-----YGEDYIEHLHGQFLNSLRMALPDLSPVVDAII--- 326

  Fly   279 KDALTSSQPLALY 291
             |||.::||.:.|
  Rat   327 -DALLAAQPRSRY 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 85/274 (31%)
adh_short 28..229 CDD:278532 67/205 (33%)
Hsd11b2NP_058777.1 type2_17beta_HSD-like_SDR_c 83..363 CDD:187665 86/275 (31%)
adh_short 83..278 CDD:278532 68/204 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..400
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1610
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X110
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.