DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and Rdh16f2

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_663399.2 Gene:Rdh16f2 / 216454 MGIID:3583955 Length:318 Species:Mus musculus


Alignment Length:319 Identity:97/319 - (30%)
Similarity:154/319 - (48%) Gaps:34/319 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLRALRRSLGLGRQQLKVDSRHVVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQ 70
            |||..|.     ||.:.......|.||||.||.|:.:|... :...|.|::.|.  |.|||:.|:
Mouse    14 LLRFFRE-----RQVVDHLQDKYVFITGCGSGFGNLLARQL-DRRGMRVLAACR--KEEGAEELR 70

  Fly    71 GLASAKDGLSRMHTLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGV-MCFGEFEWQLT 134
            ...|     .|:.|:.||:.:.::|....:.:::.:.   :..|..|:||||: :..|..||...
Mouse    71 RKTS-----ERLETVILDVTKTENIVAATQWVKERVG---NRGLWGLVNNAGISVPSGPNEWMKK 127

  Fly   135 EQIEAQINCNLLGTMRLTHELLPLLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLR 199
            :...:.::.||||.:.:|..:|||:|:.:||::||:|..|..:|...|.|..||..:..::||||
Mouse   128 QDFASVLDVNLLGLIEVTLSMLPLVRKARGRVVNVSSILGRVSLGGSGGYCISKYGIEAFSDSLR 192

  Fly   200 VELQQYGMEVVNFIPGSFVLDSNIAARQQQHAQKMREAFSAEQHALYDTYFEAFNGYLKVLSGFK 264
            .||:.:|::|....||.|:.....:||...:.|.:.:..|:|...:|...:.|  .|||.|    
Mouse   193 RELRYFGVKVAIIEPGFFLTGMASSARLCSNIQMLWDQTSSEIREIYGEKYLA--SYLKNL---- 251

  Fly   265 PPNRLRNESLLAKFKDALTSSQPLALYIEEPR-RY------RLYRWLFTLCPTPLVDWL 316
              |.|  :....|....:|.....||....|| ||      :|:....:..||.|||.|
Mouse   252 --NEL--DQRCNKDLSVVTDCMEHALTACHPRTRYSAGWDAKLFFTPLSYLPTFLVDAL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 84/280 (30%)
adh_short 28..229 CDD:278532 65/201 (32%)
Rdh16f2NP_663399.2 type2_17beta_HSD-like_SDR_c 30..307 CDD:187665 91/298 (31%)
adh_short 30..219 CDD:278532 63/199 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1610
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.