DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and DHRS7C

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001207422.1 Gene:DHRS7C / 201140 HGNCID:32423 Length:312 Species:Homo sapiens


Alignment Length:205 Identity:62/205 - (30%)
Similarity:98/205 - (47%) Gaps:14/205 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGLSRMHTLELDLLEP 92
            ||:||...||||...|...|......|:  |.........|...|.|..|...:..|.:|.||:.
Human    39 VVVITDAISGLGKECARVFHTGGARLVL--CGKNWERLENLYDALISVADPSKQTFTPKLVLLDL 101

  Fly    93 DSIRLVHRQLRDILAKDPSYRLTALINNAGVMCFG---EFEWQLTEQIEAQINCNLLGTMRLTHE 154
            ..|..|....:::|  |....:..|||||.|...|   :...:|.::|   ::.|..|.:.||..
Human   102 SDISCVPDVAKEVL--DCYGCVDILINNASVKVKGPAHKISLELDKKI---MDANYFGPITLTKA 161

  Fly   155 LLP-LLRQQQGRIINVTSHCGLQALPALGPYAASK-AALRFWTDSLRVELQQYGMEVVNFIPGSF 217
            ||| ::.::.|:|:.|.:..|...:|....||||| |||.|: |.||.|:::|.: |::.:..:|
Human   162 LLPNMISRRTGQIVLVNNIQGKFGIPFRTTYAASKHAALGFF-DCLRAEVEEYDV-VISTVSPTF 224

  Fly   218 VLDSNIAARQ 227
            :...::...|
Human   225 IRSYHVYPEQ 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 62/205 (30%)
adh_short 28..229 CDD:278532 62/205 (30%)
DHRS7CNP_001207422.1 11beta-HSD1_like_SDR_c 35..297 CDD:187593 62/205 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.