Sequence 1: | NP_651725.1 | Gene: | sro / 43512 | FlyBaseID: | FBgn0262112 | Length: | 335 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001207422.1 | Gene: | DHRS7C / 201140 | HGNCID: | 32423 | Length: | 312 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 62/205 - (30%) |
---|---|---|---|
Similarity: | 98/205 - (47%) | Gaps: | 14/205 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 VVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGLSRMHTLELDLLEP 92
Fly 93 DSIRLVHRQLRDILAKDPSYRLTALINNAGVMCFG---EFEWQLTEQIEAQINCNLLGTMRLTHE 154
Fly 155 LLP-LLRQQQGRIINVTSHCGLQALPALGPYAASK-AALRFWTDSLRVELQQYGMEVVNFIPGSF 217
Fly 218 VLDSNIAARQ 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sro | NP_651725.1 | 17beta-HSD-like_SDR_c | 27..300 | CDD:187632 | 62/205 (30%) |
adh_short | 28..229 | CDD:278532 | 62/205 (30%) | ||
DHRS7C | NP_001207422.1 | 11beta-HSD1_like_SDR_c | 35..297 | CDD:187593 | 62/205 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |