DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and dhs-2

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_491575.1 Gene:dhs-2 / 172183 WormBaseID:WBGene00000966 Length:368 Species:Caenorhabditis elegans


Alignment Length:336 Identity:92/336 - (27%)
Similarity:151/336 - (44%) Gaps:70/336 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LGR---QQLKVD--SRHVVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQGLASA 75
            :||   ::|:::  |:..|.|||||||.|..:|:.|.|. .|.|.:.|  :..:|.:.|.  |.|
 Worm    54 IGRHFIEKLQINNLSKRAVFITGCDSGFGRGLALKCLEQ-GMPVFAGC--LTEQGIESLS--AEA 113

  Fly    76 KDGLSRMHTLELDLLEPDSIRLVHRQLRDILAKDPSY-RLTALINNAGVM---CFGEFEWQLTEQ 136
            :..:....:|:..|::..|...|....:.:..|...| .|.|::||||:.   ...:| ..:.|.
 Worm   114 RKSIGNGRSLDAFLMDVTSDESVGEVAKRLEKKCEQYGGLHAVVNNAGITGKHIADDF-LDINEY 177

  Fly   137 IEAQINCNLLGTMRLTHELLPLLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVE 201
            ::. .|.||.|.:|.|..:..||::.:||::.|.|.|....||.||||:.||..:..:.|.:|.|
 Worm   178 LKV-ANINLWGPIRTTMAVKKLLKKARGRVVTVASICARVGLPGLGPYSVSKYGVSAYCDVIRQE 241

  Fly   202 LQQYGMEVVNFIPGSFVLDSNIAARQQQHAQKMREAFSAEQHALYDTYFEAFNGYLKVLSGFKPP 266
            |:.:|:.|....||.|  ::.:..|::..|    |...|.:||                     |
 Worm   242 LRPFGISVHVLEPGFF--NTPLINREKIDA----EILEAWKHA---------------------P 279

  Fly   267 NRLRNESLLAKFKDALTS---------SQPLALYIE---------EPR-RYRLYRW-------LF 305
            |.::.|.....|.||..|         |..::|.::         .|| ||:: .|       .|
 Worm   280 NEVKQEYGEKFFNDARESTHLFLNSVASSQISLVVDAYFHAITSKHPRSRYQI-GWDSILLFIPF 343

  Fly   306 TLCPTPLVDWL 316
            :..||.|.|::
 Worm   344 SYLPTGLQDYI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 82/295 (28%)
adh_short 28..229 CDD:278532 64/204 (31%)
dhs-2NP_491575.1 NADB_Rossmann 70..354 CDD:304358 88/318 (28%)
adh_short 70..261 CDD:278532 63/199 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I4444
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1882
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.