DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and Dhrs9

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_570832.1 Gene:Dhrs9 / 170635 RGDID:620655 Length:319 Species:Rattus norvegicus


Alignment Length:315 Identity:86/315 - (27%)
Similarity:152/315 - (48%) Gaps:42/315 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QLKVD--SRHVVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGLSRM 82
            |||:.  :...:.|||||||.| ::|....:.....||:.|  :...|::.|:...|     .|:
  Rat    21 QLKIADIADKYIFITGCDSGFG-NLAARTFDRKGFRVIAAC--LTESGSEALKAKTS-----ERL 77

  Fly    83 HTLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVM-CFGEFEWQLTEQIEAQINCNLL 146
            ||:.||:..|::::...:.::..:.:.   .|..|||||||: .....:|...:.....|..||.
  Rat    78 HTVLLDVTNPENVKETAQWVKSHVGEK---GLWGLINNAGVLGVLAPTDWLTVDDYREPIEVNLF 139

  Fly   147 GTMRLTHELLPLLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGMEVVN 211
            |.:.:|..:|||:::.:||:|||:|..|..|... |.|..||.|:..:.||||.:::.:|:.|..
  Rat   140 GLINVTLNMLPLVKKARGRVINVSSIGGRLAFGG-GGYTPSKYAVEGFNDSLRRDMKAFGVHVSC 203

  Fly   212 FIPGSFVLDSNIAARQQQHAQKMREAFSAEQHALYDTYFEAFNGYLKVLSGFKPPNRLRNE---- 272
            ..||.|  .:.:|...:...:|:    :..:|...|...:...||::     |..:||::.    
  Rat   204 IEPGLF--KTGLADPIKTTEKKL----AIWKHLSPDIKQQYGEGYIE-----KSLHRLKSSTSSV 257

  Fly   273 ----SLLAKFKD-ALTSSQPLALYI--EEPRRYRLYRWL-FTLCPTPLVDWLTVR 319
                ||:.:..| ||||..|...|.  ::.:.:    |: .:..|..|.|:|.::
  Rat   258 NLDLSLVVECMDHALTSLFPKTRYTAGKDAKTF----WIPLSHMPAALQDFLLLK 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 78/284 (27%)
adh_short 28..229 CDD:278532 61/201 (30%)
Dhrs9NP_570832.1 type2_17beta_HSD-like_SDR_c 30..306 CDD:187665 82/302 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 1 1.000 - - otm45084
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.