DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and Bdh1

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_446447.2 Gene:Bdh1 / 117099 RGDID:620131 Length:344 Species:Rattus norvegicus


Alignment Length:299 Identity:89/299 - (29%)
Similarity:140/299 - (46%) Gaps:37/299 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QLKVDSRHVVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGLSRMHT 84
            |....|...||:||||||.|.|:|.:.|....:....|.  :|.:|...::.|.|.|.  .|:.|
  Rat    50 QADAASGKAVLVTGCDSGFGFSLAKHLHSKGFLVFAGCL--LKDKGDAGVRELDSLKS--DRLRT 110

  Fly    85 LELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVMCFGEFEWQLTEQIEAQINCNLLGTM 149
            ::|::...:.:......:|..| |||...:..|:||||:..|||.|:...|..:.....||.||:
  Rat   111 IQLNVCNSEEVEKAVETVRSGL-KDPEKGMWGLVNNAGISTFGEVEFTSMETYKEVAEVNLWGTV 174

  Fly   150 RLTHELLPLLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGMEVVNFIP 214
            |.|...|||||:.:||::|::|..|..|.||..||..:|..:..::|.||.|:...|::|....|
  Rat   175 RTTKSFLPLLRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMHPLGVKVSVVEP 239

  Fly   215 GSFVLDSNIAA--RQQQHAQKM------------REAFSAEQHALYDTYFEAFNGYLKVLSGFKP 265
            |:|:..:::.:  |.|..|:||            .:.:..|:.|..:||..:             
  Rat   240 GNFIAATSLYSPERIQAIAKKMWDELPEVVRKDYGKKYFDEKIAKMETYCNS------------- 291

  Fly   266 PNRLRNESLLAKFKDALTSSQPLALYIEEPRRYRLYRWL 304
             ......|::.....|||::.|...|  .|..|  |.||
  Rat   292 -GSTDTSSVINAVTHALTAATPYTRY--HPMDY--YWWL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 84/286 (29%)
adh_short 28..229 CDD:278532 68/202 (34%)
Bdh1NP_446447.2 type2_17beta_HSD-like_SDR_c 57..342 CDD:187665 87/292 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1610
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 1 1.000 - - otm45084
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR43313
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.