DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and Rdh9

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_694773.1 Gene:Rdh9 / 103142 MGIID:2143528 Length:317 Species:Mus musculus


Alignment Length:308 Identity:92/308 - (29%)
Similarity:151/308 - (49%) Gaps:44/308 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGLSRMHTLELDLLEPD 93
            |.|||||||.|:.:|... :...|.|::.|  :..:||:.|:...|     .|:.|:.||:.:.:
Mouse    32 VFITGCDSGFGNLLARQL-DRRGMRVLAAC--LTEKGAEELRNKTS-----DRLETVILDVTKTE 88

  Fly    94 SIRLVHRQLRDILAKDPSYRLTALINNAGV-MCFGEFEWQLTEQIEAQINCNLLGTMRLTHELLP 157
            ||....:.:::.:.   :..|..|:||||: :..|..||...:.....::.||||.:.:|..:||
Mouse    89 SIVTATQWVKERVG---NRGLWGLVNNAGISIPSGPNEWMKKQDFAHVLDVNLLGLIEVTLSMLP 150

  Fly   158 LLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGMEVVNFIPGSFVLDSN 222
            |:|:.:||:|||.|..|..:|.. |.|..||..:..::||||.||..:|::|....||.|:....
Mouse   151 LVRKARGRVINVASVLGRVSLCG-GAYCISKYGVEAFSDSLRRELSYFGVKVAIIEPGFFLTGVT 214

  Fly   223 IAARQQQHAQKMREAFSAEQHALYDTYFEAFNGYLKVLSGFKPPNRL-----RNESLLAK-FKDA 281
            .:||...:.|.:.:..|:|...:|...:.|  .|||.|      |.|     ::.||:.. .:.|
Mouse   215 SSARLCSNTQMLWDQTSSEIREIYGEKYLA--SYLKRL------NELDKRCNKDLSLVTDCMEHA 271

  Fly   282 LTSSQPLALYIEEPRRY------RLYRWLFTLCPTPLVD----WLTVR 319
            ||:..|..       ||      :|:....:..||.|||    |.:::
Mouse   272 LTACHPRT-------RYSAGWDAKLFYLPLSYLPTFLVDALLYWTSLK 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 85/283 (30%)
adh_short 28..229 CDD:278532 66/200 (33%)
Rdh9NP_694773.1 type2_17beta_HSD-like_SDR_c 30..306 CDD:187665 91/300 (30%)
adh_short 30..218 CDD:278532 64/197 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1610
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.