DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and DHRS9

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001276692.1 Gene:DHRS9 / 10170 HGNCID:16888 Length:379 Species:Homo sapiens


Alignment Length:308 Identity:87/308 - (28%)
Similarity:149/308 - (48%) Gaps:28/308 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QLKVD--SRHVVLITGCDSGLGHSMA-VYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGLSR 81
            :||::  :...:.|||||||.|:..| .:..:..|  ||:.|  :...|:..|:...|     .|
Human    81 KLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFH--VIAAC--LTESGSTALKAETS-----ER 136

  Fly    82 MHTLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVM-CFGEFEWQLTEQIEAQINCNL 145
            :.|:.||:.:|::::...:.:::.:.:.   .|..|||||||. .....:|...|.....|..||
Human   137 LRTVLLDVTDPENVKRTAQWVKNQVGEK---GLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNL 198

  Fly   146 LGTMRLTHELLPLLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGMEVV 210
            .|.:.:|..:|||:::.|||:|||:|..|..|:.. |.|..||.|:..:.||||.:::.:|:.|.
Human   199 FGLISVTLNMLPLVKKAQGRVINVSSVGGRLAIVG-GGYTPSKYAVEGFNDSLRRDMKAFGVHVS 262

  Fly   211 NFIPGSFVLDSNIAARQQQHAQKMR--EAFSAEQHALY-DTYFEAFNGYLKVLSGFKPPNRLRNE 272
            ...||.|  .:|:|...:...:|:.  |..|.:....| :.|.|.   .|..|.|.|....:...
Human   263 CIEPGLF--KTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEK---SLDKLKGNKSYVNMDLS 322

  Fly   273 SLLAKFKDALTSSQPLALYIEEPRRYRLYRWL-FTLCPTPLVDWLTVR 319
            .::.....||||..|...| ...:..::: |: .:..|..|.|:|.::
Human   323 PVVECMDHALTSLFPKTHY-AAGKDAKIF-WIPLSHMPAALQDFLLLK 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 80/277 (29%)
adh_short 28..229 CDD:278532 64/202 (32%)
DHRS9NP_001276692.1 type2_17beta_HSD-like_SDR_c 90..366 CDD:187665 84/295 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1610
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.