DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and LOC100498221

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_002939751.1 Gene:LOC100498221 / 100498221 -ID:- Length:320 Species:Xenopus tropicalis


Alignment Length:204 Identity:72/204 - (35%)
Similarity:111/204 - (54%) Gaps:19/204 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RQQLKVDSRHVVLITGCDSGLGHSMAVYCHESLH---MTVISCCHNIKSEGAKLLQGLASAKDGL 79
            |:.||..:...|||||||||.|:.:|    :||.   |.|::.|  :.:.||:.|:     |:..
 Frog    21 RKMLKNLADKYVLITGCDSGFGNHLA----KSLDKQGMQVLAAC--LTNTGAEALK-----KEAS 74

  Fly    80 SRMHTLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAG-VMCFGEFEWQLTEQIEAQINC 143
            ||:.|:.||:.:..|::.....:..|:.   ...|..|:|||| .:.....||...|.....:|.
 Frog    75 SRLQTVILDVTDSQSVKSAVLWVTGIVG---DTGLWGLVNNAGTTIPSAPNEWLTKEDFWKVLNV 136

  Fly   144 NLLGTMRLTHELLPLLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGME 208
            |||||:.:|..||||:|:.:|||||::|..|..|... |.|:.|:..:..::||||.|||.:|:.
 Frog   137 NLLGTIDVTLALLPLIRKSRGRIINMSSVMGRLAFIG-GGYSISRHGVEAFSDSLRRELQPFGVR 200

  Fly   209 VVNFIPGSF 217
            |....|.::
 Frog   201 VSVIEPTTY 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 69/195 (35%)
adh_short 28..229 CDD:278532 69/194 (36%)
LOC100498221XP_002939751.1 NADB_Rossmann 30..306 CDD:419666 69/195 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.