DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and XB5807236

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_012811987.1 Gene:XB5807236 / 100170425 XenbaseID:XB-GENE-5807237 Length:335 Species:Xenopus tropicalis


Alignment Length:308 Identity:90/308 - (29%)
Similarity:148/308 - (48%) Gaps:46/308 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGLSRMHTLELDLLEPD 93
            |||||||||.|..:|... :...:.|::.|  :..:||:.|:     |:..||:.|:.:|:.:.:
 Frog    49 VLITGCDSGFGKLLAKQL-DGQGLKVLATC--LTQKGAEELK-----KETSSRLKTVIMDVSDSE 105

  Fly    94 SIRLVHRQLRDILAKDPSYRLTALINNAGV-MCFGEFEWQLTEQIEAQINCNLLGTMRLTHELLP 157
            |:....:.:..|:.   :..|..|:||||: :..|...|...|.....|:.||||.:.:|..|||
 Frog   106 SVSKAAQWVSQIVG---NAGLWGLVNNAGIALPIGPNGWMKKEHFVKMIDVNLLGMVDVTLTLLP 167

  Fly   158 LLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGMEVVNFIPGSF---VL 219
            |:|:.:|||:||:|..|..||.. |.|:.||..:..::|.||.||.::|::|....||.|   :.
 Frog   168 LIRRARGRIVNVSSSMGRIALFG-GAYSISKHGVEAFSDCLRRELSRFGIKVSIIEPGGFKTSIF 231

  Fly   220 DSNIAARQQQHAQKMREAFSAEQHALYDTYFEAFNGYLKVLSGFKPPNRL--RNESLLAK----F 278
            ..::..:..   :::....|||....|...:  .|..|:.:      :.|  .|.|.|.|    .
 Frog   232 SFSVCKKSM---EQLWADTSAETKECYGQQY--LNETLQTI------DELINTNSSKLCKVTNCM 285

  Fly   279 KDALTSSQPLALYIEEPRRY------RLYRWLFTLCPTPLVDWLTVRF 320
            :.|||:..|..       ||      :|:....:..||.|.|::..||
 Frog   286 EHALTACHPWT-------RYSPGWDAKLFYIPLSYLPTVLSDYVASRF 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 83/286 (29%)
adh_short 28..229 CDD:278532 66/203 (33%)
XB5807236XP_012811987.1 NADB_Rossmann 47..322 CDD:389744 88/302 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1882
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.