DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and rdh16

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001107359.1 Gene:rdh16 / 100135184 XenbaseID:XB-GENE-1007896 Length:317 Species:Xenopus tropicalis


Alignment Length:323 Identity:98/323 - (30%)
Similarity:153/323 - (47%) Gaps:52/323 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LGRQQLKVDSRHVVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGLS 80
            :||:.|...:...|.|||||||.|:.:|... :...:.|::.|  :..:||:.|:     |:..|
 Frog    19 IGRKMLPNLTDKYVFITGCDSGFGNLLAKQL-DRRGLWVLAAC--LTDKGAEELK-----KETSS 75

  Fly    81 RMHTLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVM-CFGEFEWQLTEQIEAQINCN 144
            |:.|:.|::.:..|:......:.||:.   :..|..|:||||:. .....||...|.....:|.|
 Frog    76 RLKTVILNVTDSQSVISASAWVSDIVG---NKGLWGLVNNAGISNPIAPNEWLSKEDYLKVLNVN 137

  Fly   145 LLGTMRLTHELLPLLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGMEV 209
            |||.:.:|.:||||:|:.:|||:||.|..|..:|.. |.|:.||..:..::||||.|:.|:|::|
 Frog   138 LLGVIDITLKLLPLIRKARGRIVNVASVAGRVSLCG-GGYSISKYGVESFSDSLRREMAQFGIKV 201

  Fly   210 VNFIPGSF---VLDSN--------IAARQQQHAQKMREAFSAEQHALYDTYFEAFNGYLKVLSGF 263
            ....||.|   |.|:|        |.|:..||   :||.:..|       |||.:..        
 Frog   202 SIVEPGYFKTPVADANTQKKFLNEIWAKLPQH---IRETYGQE-------YFEKYCN-------- 248

  Fly   264 KPPNRLRNESLLAKFKDALTSSQPLALYIEEPR-RY------RLYRWLFTLCPTPLVDWLTVR 319
               |..||...::.....:|.....||....|| ||      :|:....:..||..:|:|..|
 Frog   249 ---NVERNLEKVSSKLHLVTDCMEHALTAVYPRTRYSAGWDAKLFFIPLSYLPTVCIDFLLNR 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 89/291 (31%)
adh_short 28..229 CDD:278532 71/212 (33%)
rdh16NP_001107359.1 type2_17beta_HSD-like_SDR_c 30..306 CDD:187665 93/308 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1882
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.