DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and rdh7.2

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001107972.1 Gene:rdh7.2 / 100135028 XenbaseID:XB-GENE-1007886 Length:317 Species:Xenopus tropicalis


Alignment Length:321 Identity:87/321 - (27%)
Similarity:150/321 - (46%) Gaps:66/321 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RHV--------VLITGCDSGLGHSMAVYCHESLH---MTVISCCHNIKSEGAKLLQGLASAKDGL 79
            ||:        |||||||||.|:.:|    .:|.   :.|::.|  :...||:.|:     |...
 Frog    21 RHILHNLTDKYVLITGCDSGFGNLLA----RNLDRRGIRVLAAC--LTDRGAEELK-----KQTS 74

  Fly    80 SRMHTLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVM--CFGEFEWQLTEQIEAQIN 142
            .|:.|:.||:.:.:|::........|:.   ...|..|:||||:.  | ...||...|.....:|
 Frog    75 DRLQTVLLDVTDSNSVKTAANWASQIVG---DKGLWGLVNNAGISFPC-APNEWLTKEDFMKVMN 135

  Fly   143 CNLLGTMRLTHELLPLLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGM 207
            .||||.:.:|..:|.|:|:.:||::|:.|..|...:.. |.|..||..:..::||||.|::.:|:
 Frog   136 VNLLGLIDVTINMLHLIRKARGRVVNIASVAGRITISG-GGYCMSKYGVESFSDSLRREMRPFGV 199

  Fly   208 EVVNFIPGSF---VLDSNIAARQQQHA-----QKMREAFSAEQHALYDTYF-EAFNGYLKVLSGF 263
            :|....||.|   :.::::..:..:.|     :::|:::..|       || ::.|....::   
 Frog   200 KVCIVEPGFFKTQITNTDLVKQSLERAWNSTTEEIRQSYGQE-------YFKKSCNASQTIV--- 254

  Fly   264 KPPNRLRNESLLAK-FKDALTSSQPLALYIEEPRRYRLYRW----LF---TLCPTPLVDWL 316
              |....|.||:.. .:.|||::.|...|..        .|    ||   :..||.:||:|
 Frog   255 --PLCKANLSLVTDCLEHALTAAHPRTRYSA--------GWDAKLLFLPLSYFPTSVVDFL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 78/295 (26%)
adh_short 28..229 CDD:278532 62/216 (29%)
rdh7.2NP_001107972.1 type2_17beta_HSD-like_SDR_c 30..306 CDD:187665 85/312 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1882
SonicParanoid 1 1.000 - - X110
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.