DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr24 and MSI1

DIOPT Version :9

Sequence 1:NP_733303.2 Gene:Wdr24 / 43505 FlyBaseID:FBgn0027518 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_009754.1 Gene:MSI1 / 852494 SGDID:S000000399 Length:422 Species:Saccharomyces cerevisiae


Alignment Length:218 Identity:54/218 - (24%)
Similarity:94/218 - (43%) Gaps:23/218 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 ANDVAWSTLDSNLLATAATNGVVSVWDLSKFGRQK-----QLLVYNEHERTAHTVTFHSSEPNIL 127
            |..:||:.....||.::.:||.|.|||:.::..:.     .|:..|......:.||:..:..::.
Yeast   203 ATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGTAVNDVTWMPTHDSLF 267

  Fly   128 ISGSQDGTIKCFDIRSDKSINTYFCNSE----SVRDVKFSPHTQNIFSAVSENGTVQLWDMRKWD 188
            .:.::...:...|:|:.|  .....|.|    .|...:|:.....|.::...||.:.|||:|..:
Yeast   268 AACTEGNAVSLLDLRTKK--EKLQSNREKHDGGVNSCRFNYKNSLILASADSNGRLNLWDIRNMN 330

  Fly   189 KCMVQFTAHYGPVYTCDWHPTRNW-LAT-GSRDKQIKVWNMDGRPGLEHTIHT----IAVVGRVK 247
            |..:....|...|.|.:|.|..:. ||| |..|..:|:|:    ...|.||.|    :..|..:.
Yeast   331 KSPIATMEHGTSVSTLEWSPNFDTVLATAGQEDGLVKLWD----TSCEETIFTHGGHMLGVNDIS 391

  Fly   248 WRPERTYHIASCALVVDYSVHVW 270
            |.....:  ..|::..|.|||:|
Yeast   392 WDAHDPW--LMCSVANDNSVHIW 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr24NP_733303.2 WD40 13..311 CDD:238121 54/218 (25%)
WD40 22..>312 CDD:225201 54/218 (25%)
WD40 repeat 70..109 CDD:293791 11/43 (26%)
WD40 repeat 115..152 CDD:293791 5/36 (14%)
WD40 repeat 157..194 CDD:293791 10/36 (28%)
WD40 repeat 202..236 CDD:293791 11/35 (31%)
WD40 repeat 243..283 CDD:293791 8/28 (29%)
Zn_ribbon_17 <720..777 CDD:305234
MSI1NP_009754.1 CAF1C_H4-bd 21..88 CDD:403473
WD40 repeat 133..173 CDD:293791
WD40 141..413 CDD:421866 54/218 (25%)
WD40 repeat 203..247 CDD:293791 12/43 (28%)
WD40 repeat 255..292 CDD:293791 5/38 (13%)
WD40 repeat 299..338 CDD:293791 10/38 (26%)
WD40 repeat 343..381 CDD:293791 15/41 (37%)
WD40 repeat 387..412 CDD:293791 7/26 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4827
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.