DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr24 and l(2)09851

DIOPT Version :9

Sequence 1:NP_733303.2 Gene:Wdr24 / 43505 FlyBaseID:FBgn0027518 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_001260713.1 Gene:l(2)09851 / 46662 FlyBaseID:FBgn0022288 Length:456 Species:Drosophila melanogaster


Alignment Length:290 Identity:58/290 - (20%)
Similarity:108/290 - (37%) Gaps:94/290 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 ESCNMRGKNQNLSYSANDVAWSTLDSNLLATAATNGVVSVWDL---------SKFGRQ------K 102
            :.|..|.:.:.|..|....:||.|           |.|::|||         ::..:|      :
  Fly   160 QGCVNRVRARRLGNSVYAASWSEL-----------GRVNIWDLTQPLQAVENAQLAKQYEQSEAR 213

  Fly   103 QLLVYNEHERTAHTVTFHSSEPNILISGS-----------QDGTIKCFDIRSDKSINTYFCNSES 156
            .:..:..|::....:.:..|...:|.:|.           :|||.| .|.|....      :|:|
  Fly   214 PVFTFGGHQQEGFAIDWSPSADGVLATGDCRRDIHVWTPVEDGTWK-VDQRPLAG------HSQS 271

  Fly   157 VRDVKFSPHTQNIFSAVSENGTVQLWDMRKWDK--CMVQF-TAHYGPVYTCDWHPTRNWLATGSR 218
            |.|:::||:.:::.::.|.:.|:::||.|...:  ||:.. .||...|....|:....::|:|..
  Fly   272 VEDLQWSPNERSVLASCSVDKTIRIWDCRASPQKACMLTCEDAHQSDVNVISWNRNEPFIASGGD 336

  Fly   219 DKQIKVWNMDGRPGLEHTIHTIAVVGRVKWRPERTYHIASCALVVDYSVHVWDIR--RPYIPFAS 281
            |..:                                             |:||:|  :...|.|:
  Fly   337 DGYL---------------------------------------------HIWDLRQFQSKKPIAT 356

  Fly   282 FNEHTNVTTGIAWQGSDSHCLLSISKDSTI 311
            |..||:..|.:.|..:::..|.|...|..|
  Fly   357 FKHHTDHITTVEWSPAEATVLASGGDDDQI 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr24NP_733303.2 WD40 13..311 CDD:238121 57/288 (20%)
WD40 22..>312 CDD:225201 58/290 (20%)
WD40 repeat 70..109 CDD:293791 9/53 (17%)
WD40 repeat 115..152 CDD:293791 9/47 (19%)
WD40 repeat 157..194 CDD:293791 11/38 (29%)
WD40 repeat 202..236 CDD:293791 4/33 (12%)
WD40 repeat 243..283 CDD:293791 6/41 (15%)
Zn_ribbon_17 <720..777 CDD:305234
l(2)09851NP_001260713.1 CAF1C_H4-bd 53..120 CDD:289068
WD40 152..>395 CDD:295369 58/290 (20%)
WD40 <172..>447 CDD:225201 55/278 (20%)
WD40 repeat 226..267 CDD:293791 9/41 (22%)
WD40 repeat 272..312 CDD:293791 11/39 (28%)
WD40 repeat 320..357 CDD:293791 10/81 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456809
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.