DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gnpnat and AT2G39020

DIOPT Version :10

Sequence 1:NP_001263081.1 Gene:Gnpnat / 43504 FlyBaseID:FBgn0039690 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_181435.1 Gene:AT2G39020 / 818488 AraportID:AT2G39020 Length:236 Species:Arabidopsis thaliana


Alignment Length:54 Identity:18/54 - (33%)
Similarity:30/54 - (55%) Gaps:3/54 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 LEDVVVNDTYRGKQLGKLIVVTVSLLAEELGCYKMS---LDCKDKLIKFYESLG 168
            :||:.|.:.||.|..|.:::..|:..|.::|..::.   ||.....|||||.:|
plant   158 IEDIFVREPYRRKGFGSMLLTAVAKQAVKMGYGRVEWVVLDWNVNAIKFYEQMG 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GnpnatNP_001263081.1 N-Acyltransferase superfamily: Various enyzmes that characteristicly catalyze the transfer of an acyl group to a substrate 39..170 CDD:473072 18/54 (33%)
AT2G39020NP_181435.1 MnaT 33..221 CDD:440860 18/54 (33%)

Return to query results.
Submit another query.