DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gnpnat and flp-24

DIOPT Version :10

Sequence 1:NP_001263081.1 Gene:Gnpnat / 43504 FlyBaseID:FBgn0039690 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_497243.3 Gene:flp-24 / 182824 WormBaseID:WBGene00016028 Length:69 Species:Caenorhabditis elegans


Alignment Length:46 Identity:8/46 - (17%)
Similarity:23/46 - (50%) Gaps:1/46 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 TRKNEIIGAASLVIERKFIHNCA-VRGRLEDVVVNDTYRGKQLGKL 135
            :|.:.||...::::....:..|. ::..:|::.....:|..|.|::
 Worm     4 SRTSSIILILAILVAIMAVAQCRNIQYDVEEMTPEAAFRYAQWGEI 49

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GnpnatNP_001263081.1 N-Acyltransferase superfamily: Various enyzmes that characteristicly catalyze the transfer of an acyl group to a substrate 39..170 CDD:473072 8/46 (17%)
flp-24NP_497243.3 None

Return to query results.
Submit another query.