DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIA30 and AT1G72420

DIOPT Version :9

Sequence 1:NP_651718.1 Gene:CIA30 / 43503 FlyBaseID:FBgn0039689 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001320990.1 Gene:AT1G72420 / 843574 AraportID:AT1G72420 Length:228 Species:Arabidopsis thaliana


Alignment Length:203 Identity:55/203 - (27%)
Similarity:100/203 - (49%) Gaps:37/203 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 VFDFKAPDVLDKWTVTTDADHGEGKSTATLELSAAG-----AGLFHGQVNSDHTKDGI---IKRT 147
            :|.|.:.:.|..|.:.:|:::| |.|:|:||:...|     .|:|.|.:::| .::|.   |.|:
plant    34 IFKFNSKEDLKTWHLYSDSEYG-GLSSASLEIKDGGNRSDCNGVFSGNLSTD-MREGSKWNINRS 96

  Fly   148 GYANIRTKRVRKSFKRETTYDWTQYNMLVMKVRGDGRSYLINLHTEGYF-------DLMWNDIYH 205
            |:..:|:|      |.:...|...|:.:.::::||||.|:..::||.:.       |..|.   .
plant    97 GFCGMRSK------KFDGFIDLEGYDSIALRLKGDGRCYISTIYTENWVNSPGQAEDNSWQ---A 152

  Fly   206 YVLYTRGGPHWQIAKIPFSKFFLSSKGRVQDRQGAIPLNRVTHFGFSV--------AAKKGMDGP 262
            :|...:|  :|..||:|.:::..:.||.|.|.:..:....|.....||        .||.|. |.
plant   153 FVFAPKG--NWYTAKVPLTRYLPTWKGNVIDAEMEMNPGHVVGMSLSVNAQGGGFIGAKSGA-GD 214

  Fly   263 FGLEIDYV 270
            |.:|||::
plant   215 FQVEIDWI 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIA30NP_651718.1 CIA30 92..267 CDD:285718 52/197 (26%)
AT1G72420NP_001320990.1 CIA30 35..219 CDD:400728 52/197 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I3576
eggNOG 1 0.900 - - E1_KOG2435
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I2467
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1563319at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3024
orthoMCL 1 0.900 - - OOG6_103519
Panther 1 1.100 - - O PTHR13194
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.