DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIA30 and AT1G17350

DIOPT Version :9

Sequence 1:NP_651718.1 Gene:CIA30 / 43503 FlyBaseID:FBgn0039689 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001154347.1 Gene:AT1G17350 / 838307 AraportID:AT1G17350 Length:236 Species:Arabidopsis thaliana


Alignment Length:193 Identity:51/193 - (26%)
Similarity:91/193 - (47%) Gaps:34/193 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 VFDFKAPDVLDKWTVTTDADHGEGKSTATLELSAAG-----AGLFHGQVNSDHTKDG--IIKRTG 148
            :|.|.:.:.|.||.:.:|:::| |.|:|:||:...|     .|:|.|.::.|.::..  .|.|:|
plant    34 IFKFHSKEDLKKWHLYSDSEYG-GLSSASLEIPDKGDGSDCTGVFSGNLSVDLSEGSKWNISRSG 97

  Fly   149 YANIRTKRVRKSFKRETTYDWTQYNMLVMKVRGDGRSYLINLHTEGYF-------DLMWNDIYHY 206
            :..:|:|      |.:...|...|:.:.:::|||||.|:..::||.:.       |..|.   .:
plant    98 FCGMRSK------KFDGFIDLDGYDAIALRIRGDGRCYISTIYTENWVNSPGQSEDNSWQ---AF 153

  Fly   207 VLYTRGGPHWQIAK--------IPFSKFFLSSKGRVQDRQGAIPLNRVTHFGFSVAAKKGMDG 261
            |...:..  |..||        ||.:::..:.:|.|.|.:..:...||.....||.|:.|..|
plant   154 VFAPKDS--WYTAKASPTTSIDIPLARYLPTWRGNVIDVEMEMNPGRVLGMSLSVNAEGGAVG 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIA30NP_651718.1 CIA30 92..267 CDD:285718 51/192 (27%)
AT1G17350NP_001154347.1 CIA30 35..223 CDD:285718 51/192 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I3576
eggNOG 1 0.900 - - E1_KOG2435
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I2467
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1563319at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3024
orthoMCL 1 0.900 - - OOG6_103519
Panther 1 1.100 - - LDO PTHR13194
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.