DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIA30 and AT4G18810

DIOPT Version :9

Sequence 1:NP_651718.1 Gene:CIA30 / 43503 FlyBaseID:FBgn0039689 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001190764.1 Gene:AT4G18810 / 827615 AraportID:AT4G18810 Length:627 Species:Arabidopsis thaliana


Alignment Length:200 Identity:43/200 - (21%)
Similarity:79/200 - (39%) Gaps:51/200 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 GEGKSTATLELSA----AGAGLFHGQVNSDHTKDGIIKRTGYANIRTKRVRKSFKRETTYDWTQY 172
            |..:|...::|:|    ...|:|.|.|::  |.:|     |:.::|||...:: :..:.||.   
plant   278 GVSESNFIVDLTAGENGGPTGIFKGIVST--TNNG-----GFTSVRTKNFPEA-ENVSAYDG--- 331

  Fly   173 NMLVMKVRGDGRSYLINLHTEGYFDLMWNDIYHYVLYTRGGPHWQIAKIPFSKFFLSSKGRVQDR 237
              |.::::|||..|.:.:.|    ...|:.:.:...:......||..::|||.  |....|.:..
plant   332 --LELRLKGDGLRYKLIVRT----SQDWDTVGYTASFDTSPGQWQSVRLPFSS--LRPVFRARTV 388

  Fly   238 QGAIPLNRVTHFGFSVAAKK----------GMDGPFGLEID----YVGLEYDPSHREEFAYEMYQ 288
            ..|.|.|..:.....:...|          ..:|||.|.:.    |:   .||           .
plant   389 TDAPPFNASSIISLQLMFSKFEYDGKLNPTFKEGPFELPLSSIRAYI---QDP-----------V 439

  Fly   289 TPKYI 293
            ||:::
plant   440 TPRFV 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIA30NP_651718.1 CIA30 92..267 CDD:285718 38/168 (23%)
AT4G18810NP_001190764.1 NADB_Rossmann 125..>242 CDD:304358
YbjT 125..>210 CDD:223774
CIA30 268..428 CDD:285718 38/168 (23%)
NADB_Rossmann <442..549 CDD:304358 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.