DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7601 and CG8888

DIOPT Version :9

Sequence 1:NP_651717.1 Gene:CG7601 / 43502 FlyBaseID:FBgn0027583 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster


Alignment Length:317 Identity:75/317 - (23%)
Similarity:112/317 - (35%) Gaps:97/317 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GKVVLITGASSGLGESLAHVFYRAGCRVILA----------ARRTQELERVKKDLLALDVD---- 103
            ||.|||||..:.|...||......|..|...          |:..:|:...:..||.|||.    
  Fly    95 GKGVLITGCEAPLAWYLAKKLDDLGFTVYAGFNTPIEESDEAKILKEVTSGRMKLLHLDVTSEKT 159

  Fly   104 ----PAYPPTVLP---------------LDLAELNSIPEFVTRVLAVYNQVDILINNGGISVRAD 149
                ..|....||               :.|.||..||..|.|                      
  Fly   160 ILEAARYVSQHLPHGAEGLWSVVHCAHWIALGELEWIPFAVLR---------------------- 202

  Fly   150 VASTAVDVDLKVMVVNYFGSVALTKALLPSMVKRGSGHICFISSVQGKFAIPQRAAYSASKHAMQ 214
                      |.:.:|..||..||:..|| :|:|..|.:.|::|...:...|.|....|::.|:.
  Fly   203 ----------KSLDLNLLGSARLTQIFLP-LVRRAHGRVVFLTSGLNRVPSPVRGIQCATQAAVD 256

  Fly   215 AFADSLRAEVANKNINVSCVSPGYI--------RTQL------SLNALTG-SGSSYGKVDETTAK 264
            .||..||.|:..:.::||.|:.|..        .|:|      ..|.|:. ...:||: |...|.
  Fly   257 CFAACLRQEMRTRGVDVSVVAAGEFAPGNGWLNETELRDQAKQMWNQLSSEQKKTYGE-DYYEAA 320

  Fly   265 GMSPDKLAER----------ILQCILRKEP----DIIVSDVQAKIAYYLRHLCPSLY 307
            ..|.:|.:.:          ::..:.|..|    ..:.|..:.:| :...||.||||
  Fly   321 MTSVEKYSRQAADIQPTLRVLIDAVTRTFPMARYTPVTSSERLQI-FLAEHLAPSLY 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7601NP_651717.1 11beta-HSD1_like_SDR_c 51..310 CDD:187593 75/317 (24%)
PRK06181 53..314 CDD:235726 75/317 (24%)
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 74/316 (23%)
adh_short 96..293 CDD:278532 55/229 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.