DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7601 and CG31937

DIOPT Version :9

Sequence 1:NP_651717.1 Gene:CG7601 / 43502 FlyBaseID:FBgn0027583 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster


Alignment Length:278 Identity:88/278 - (31%)
Similarity:151/278 - (54%) Gaps:24/278 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VLYWVLGTVLMPVALPLAIINIWQRFQAQKFRNQLPGKVVLITGASSGLGESLAHVFYRAGCRVI 81
            |||:|: .||:.:.|...:. :|.:.:.....:.:.|:||.|||||||:|.:||....|.|.:::
  Fly    12 VLYYVV-YVLLWILLDCNVA-LWYKSRFGVSLSSMRGQVVWITGASSGIGRALALSLARHGVKLV 74

  Fly    82 LAARRTQELERVKKDLLAL--------DVDPAYPPTVLPLDLAELNSIPEFVTRVLAVYNQVDIL 138
            |:|||.::||:|:::.||.        ||      .|:.:|:.:|:.....:..||..::::|:|
  Fly    75 LSARRLEQLEQVQEECLAAARGLLATKDV------LVIQMDMLDLDEHKTHLNTVLNHFHRLDVL 133

  Fly   139 INNGGISVRADVASTAVDVDLKVMVVNYFGSVALTKALLPSMVKR--GSGHICFISSVQGKFAIP 201
            :||.|.|.||......::||.::..::.|..|.|::.::...|::  |.|||...||:.|...:|
  Fly   134 VNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIAGFSPVP 198

  Fly   202 QRAAYSASKHAMQAFADSLRAEVANKNINVSCVSPGYIRTQLSLNALTGSGSSYGKVDETTA--K 264
            ....|.|:|||:.|:..||:.|:  :.::||..:||.|.|.....|.|||..  |||..:||  |
  Fly   199 FSPTYCAAKHALNAYLLSLKVEM--RKLDVSLFAPGPIATDFLQEAFTGSQG--GKVGLSTANQK 259

  Fly   265 GMSPDKLAERILQCILRK 282
            .|:..:..:.....:..|
  Fly   260 RMTAQRCGDLFAVALANK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7601NP_651717.1 11beta-HSD1_like_SDR_c 51..310 CDD:187593 80/244 (33%)
PRK06181 53..314 CDD:235726 80/242 (33%)
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 80/244 (33%)
adh_short 47..245 CDD:278532 68/205 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435073
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D429842at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm51358
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.