DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kul and Adamdec1

DIOPT Version :10

Sequence 1:NP_651716.1 Gene:Kul / 43501 FlyBaseID:FBgn0039688 Length:1537 Species:Drosophila melanogaster
Sequence 2:NP_001388589.1 Gene:Adamdec1 / 290338 RGDID:1309861 Length:468 Species:Rattus norvegicus


Alignment Length:218 Identity:49/218 - (22%)
Similarity:79/218 - (36%) Gaps:71/218 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   576 AYMFTYRDFEMGTLGLAWTGDLKNAGGVC-----EKNGHYRGSLKSLNTGIVTLLNYGKHVPPAV 635
            |.:.:...|..|.:|:|....|.....|.     .||          |..:|.|           
  Rat   305 AQLLSGAGFLHGRVGMAAANSLCTTSSVSVIEAKRKN----------NVALVAL----------- 348

  Fly   636 SHVTLAHEIGHNFGSPHDP--EQCTPGGEDGNFIMFARATSGDKKNNNKFSTCSLKSIEPVLNAK 698
                ::||:||..|....|  .:|    ..|:.:|....:|...|:   |||.|....:..|:::
  Rat   349 ----MSHELGHALGMQDVPYYTKC----PSGSCVMNQYLSSKFPKD---FSTVSRSRFQGFLSSR 402

  Fly   699 ARSMKGCFTEPQSSI---CGNGVVEPGEQCDCGWEEDCKDSCCFPMSRQPRLDETPCTLTPHARC 760
            .........:|::.|   |||.:::.||.||||..|:|.:.||.|::                  
  Rat   403 NTRCLLLAPDPKNIIKPTCGNRLLDMGEGCDCGSPEECTNLCCEPLT------------------ 449

  Fly   761 SPSQGPCCTTDCKLKFGDKCRDD 783
                       |:||....||::
  Rat   450 -----------CRLKSQPDCREE 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KulNP_651716.1 Pep_M12B_propep 70..186 CDD:460254
ZnMc_TACE_like 479..713 CDD:239798 29/143 (20%)
Disintegrin 720..801 CDD:459709 16/64 (25%)
Adamdec1NP_001388589.1 Pep_M12B_propep 44..175 CDD:460254
Reprolysin 217..411 CDD:426256 28/137 (20%)
Disintegrin 427..>454 CDD:471982 13/55 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.