DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa40 and NAT4

DIOPT Version :9

Sequence 1:NP_651715.1 Gene:Naa40 / 43500 FlyBaseID:FBgn0039687 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_013785.1 Gene:NAT4 / 855091 SGDID:S000004673 Length:285 Species:Saccharomyces cerevisiae


Alignment Length:187 Identity:42/187 - (22%)
Similarity:78/187 - (41%) Gaps:43/187 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LESLSYQSYKAPSGEEFKLICRAKSDADSKLLKWAFKLAETNVGPYYKQL-------KMGWQPKI 83
            ::||...:||.           .||..| ::|....:|.:.::|..|::.       :..|:.. 
Yeast    82 VDSLKCINYKL-----------HKSRGD-QVLDACVQLIDKHLGAKYRRASRIMYGNRKPWKAN- 133

  Fly    84 KAAELNKNWARYLVAQNEKKENVAYAMFRFDMD----HGDC-------VLYCYEMQVAAEYRRKG 137
            |.||: |:.....|...:.....|:..|....:    .||.       |:|.||:.||:.:|..|
Yeast   134 KLAEM-KSAGLVYVCYWDNGVLGAFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHG 197

  Fly   138 LGKFIM--STLEDCARLWHLEK-------VMLTVLNNNEASISFFKQLGYVKDEISP 185
            :|:.::  :..:..||  |..:       |.|||.::|..:...::.||:.:...||
Yeast   198 IGRRLLEHALCDGVAR--HTRRMCDNFFGVALTVFSDNTRARRLYEALGFYRAPGSP 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa40NP_651715.1 Acetyltransf_1 106..179 CDD:278980 23/92 (25%)
NAT4NP_013785.1 Acetyltransf_1 <139..245 CDD:395465 24/107 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102911
Panther 1 1.100 - - LDO PTHR20531
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1911
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.