DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa40 and NAA40

DIOPT Version :9

Sequence 1:NP_651715.1 Gene:Naa40 / 43500 FlyBaseID:FBgn0039687 Length:202 Species:Drosophila melanogaster
Sequence 2:XP_011543556.1 Gene:NAA40 / 79829 HGNCID:25845 Length:300 Species:Homo sapiens


Alignment Length:181 Identity:65/181 - (35%)
Similarity:105/181 - (58%) Gaps:7/181 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NPLESLS-YQSYKAPSGEEFKLICRAKSDADSKLLKWAFKLAETNVGPYYKQLKMGWQPKIKAAE 87
            :|||:.. ::.|.. :|....:.|:..|..:...:.|||.|.:||:...|:|.:.||:.:.|..|
Human   100 DPLEAFPVFKKYDR-NGLNVSIECKRVSGLEPATVDWAFDLTKTNMQTMYEQSEWGWKDREKREE 163

  Fly    88 LNKNWARYLVAQNEKKENVAYAMFRFDMDHGDCVLYCYEMQVAAEYRRKGLGKFIMSTLEDCARL 152
            :..:.|.||:|.......||::.||||::.||.||||||:|:.::.||||||||::..|:..|..
Human   164 MTDDRAWYLIAWENSSVPVAFSHFRFDVECGDEVLYCYEVQLESKVRRKGLGKFLIQILQLMANS 228

  Fly   153 WHLEKVMLTVLNNNEASISFFKQ-LGYVKDEISPDVL----EQADYQIFSK 198
            ..::||||||..:|..:..||:: |.:..|:.||.:.    |...|:|.|:
Human   229 TQMKKVMLTVFKHNHGAYQFFREALQFEIDDSSPSMSGCCGEDCSYEILSR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa40NP_651715.1 Acetyltransf_1 106..179 CDD:278980 35/73 (48%)
NAA40XP_011543556.1 Acetyltransf_1 180..250 CDD:278980 33/69 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153105
Domainoid 1 1.000 79 1.000 Domainoid score I8710
eggNOG 1 0.900 - - E1_KOG2488
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41588
Inparanoid 1 1.050 121 1.000 Inparanoid score I4759
Isobase 1 0.950 - 0 Normalized mean entropy S5490
OMA 1 1.010 - - QHG57159
OrthoDB 1 1.010 - - D1489686at2759
OrthoFinder 1 1.000 - - FOG0004357
OrthoInspector 1 1.000 - - oto89725
orthoMCL 1 0.900 - - OOG6_102911
Panther 1 1.100 - - LDO PTHR20531
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1911
SonicParanoid 1 1.000 - - X4736
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1817.750

Return to query results.
Submit another query.