DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa40 and Naa40

DIOPT Version :9

Sequence 1:NP_651715.1 Gene:Naa40 / 43500 FlyBaseID:FBgn0039687 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_081919.1 Gene:Naa40 / 70999 MGIID:1918249 Length:237 Species:Mus musculus


Alignment Length:189 Identity:68/189 - (35%)
Similarity:109/189 - (57%) Gaps:7/189 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VETAARAKNPLESLS-YQSYKAPSGEEFKLICRAKSDADSKLLKWAFKLAETNVGPYYKQLKMGW 79
            |:.|.|..:|||:.. ::.|.. :|....:.|:..|..:...:.|||.|.:||:...|:|.:.||
Mouse    29 VDAANRLGDPLEAFPVFKKYDR-NGLNVSIECKRVSGLEPATVDWAFDLTKTNMQTMYEQSEWGW 92

  Fly    80 QPKIKAAELNKNWARYLVAQNEKKENVAYAMFRFDMDHGDCVLYCYEMQVAAEYRRKGLGKFIMS 144
            :.:.|..|:..:.|.||:|.......||::.||||::.||.||||||:|:.::.||||||||::.
Mouse    93 KDREKREEMTDDRAWYLIAWENSSIPVAFSHFRFDVECGDEVLYCYEVQLESKVRRKGLGKFLIQ 157

  Fly   145 TLEDCARLWHLEKVMLTVLNNNEASISFFKQ-LGYVKDEISPDVL----EQADYQIFSK 198
            .|:..|....::||||||..:|..:..||:: |.:..|:.||.:.    |...|:|.|:
Mouse   158 ILQLMANSTQMKKVMLTVFKHNHGAYQFFREALQFEIDDSSPSMSGCCGEDCSYEILSR 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa40NP_651715.1 Acetyltransf_1 106..179 CDD:278980 35/73 (48%)
Naa40NP_081919.1 Acetyltransf_1 80..188 CDD:366181 45/107 (42%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q86UY6 127..129 1/1 (100%)
Acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:Q86UY6 140..142 0/1 (0%)
Acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:Q86UY6 148..153 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843204
Domainoid 1 1.000 79 1.000 Domainoid score I8729
eggNOG 1 0.900 - - E1_KOG2488
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41588
Inparanoid 1 1.050 120 1.000 Inparanoid score I4771
Isobase 1 0.950 - 0 Normalized mean entropy S5490
OMA 1 1.010 - - QHG57159
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004357
OrthoInspector 1 1.000 - - oto93295
orthoMCL 1 0.900 - - OOG6_102911
Panther 1 1.100 - - LDO PTHR20531
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1911
SonicParanoid 1 1.000 - - X4736
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.740

Return to query results.
Submit another query.