DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa40 and naa40

DIOPT Version :9

Sequence 1:NP_651715.1 Gene:Naa40 / 43500 FlyBaseID:FBgn0039687 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_588054.1 Gene:naa40 / 2539448 PomBaseID:SPCC825.04c Length:204 Species:Schizosaccharomyces pombe


Alignment Length:153 Identity:39/153 - (25%)
Similarity:71/153 - (46%) Gaps:9/153 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LLKWAFKLAETNVGPYYKQLKMGWQPKIKAAELNKNWARYL-VAQNEKKENVAYAMFRFDMDHGD 119
            ||:..|.|.:.|:...|:|...||....|..|:......|: :.:...|:.|.:..|...::.|.
pombe    48 LLQQCFNLVKKNMEALYRQSSFGWDDSEKLKEMEMEKLEYICIFEKTSKKLVGFLSFEDTVEAGL 112

  Fly   120 CVLYCYEMQVAAEYRRKGLGKFIMSTLEDCARLWHLEKVMLTVLNNNEASISFFKQLGYVKDEIS 184
            ..||.||:|:....|.:.:||:::......|...:|:.:.|||.:.|..:::|:....:|..|.|
pombe   113 TCLYIYEIQLDEHIRGRNVGKWLLKNASILAYRRNLKYIFLTVFSANLNALNFYHHFDFVPHESS 177

  Fly   185 PD--------VLEQADYQIFSKS 199
            |.        |:....|.:::||
pombe   178 PQEKKFRSGKVIHPDYYILYTKS 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa40NP_651715.1 Acetyltransf_1 106..179 CDD:278980 18/72 (25%)
naa40NP_588054.1 Acetyltransf_1 97..172 CDD:278980 18/74 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2488
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I1986
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004357
OrthoInspector 1 1.000 - - oto101138
orthoMCL 1 0.900 - - OOG6_102911
Panther 1 1.100 - - LDO PTHR20531
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1911
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.850

Return to query results.
Submit another query.