DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa40 and F54E7.9

DIOPT Version :10

Sequence 1:NP_651715.1 Gene:Naa40 / 43500 FlyBaseID:FBgn0039687 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_498219.1 Gene:F54E7.9 / 175784 WormBaseID:WBGene00018831 Length:167 Species:Caenorhabditis elegans


Alignment Length:70 Identity:22/70 - (31%)
Similarity:36/70 - (51%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 VLYCYEMQVAAEYRRKGLGKFIMSTLEDCARLWHLEKVMLTVLNNNEASISFFKQLGYVKDEISP 185
            |||.....|...:|..|||.|:|..:::..:|..|...||.|..:|:.:|.|:|..|:..|.:.|
 Worm    84 VLYIRSFGVHPRHREAGLGSFLMDFVDEKGKLLKLPHAMLHVQTSNKTAIEFYKNRGFNVDCLVP 148

  Fly   186 DVLEQ 190
            ...::
 Worm   149 QYYQR 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa40NP_651715.1 RimI 107..186 CDD:440224 21/64 (33%)
F54E7.9NP_498219.1 RimI 80..166 CDD:440224 22/70 (31%)

Return to query results.
Submit another query.