DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa40 and LOC101882407

DIOPT Version :9

Sequence 1:NP_651715.1 Gene:Naa40 / 43500 FlyBaseID:FBgn0039687 Length:202 Species:Drosophila melanogaster
Sequence 2:XP_005173515.1 Gene:LOC101882407 / 101882407 -ID:- Length:137 Species:Danio rerio


Alignment Length:109 Identity:31/109 - (28%)
Similarity:62/109 - (56%) Gaps:2/109 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VETAARAKNPLESLS-YQSYKAPSGEEFKLICRAKSDADSKLLKWAFKLAETNVGPYYKQLKMGW 79
            |:.|.:.::||.::. ::.|.. :|...::.|:..:......::||::|...|:...|:|.:.||
Zfish    29 VDAANKLEDPLSAMPVFKKYDR-NGLNLQIECKRVTALSPDTVEWAYELTRANMQTLYEQSEWGW 92

  Fly    80 QPKIKAAELNKNWARYLVAQNEKKENVAYAMFRFDMDHGDCVLY 123
            :.:.|..|:....|.||:|::.....:|::.||||::.||.|||
Zfish    93 KEREKREEMKDERAWYLLARDADSTPLAFSHFRFDVECGDEVLY 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa40NP_651715.1 Acetyltransf_1 106..179 CDD:278980 10/18 (56%)
LOC101882407XP_005173515.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588137
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1489686at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.800

Return to query results.
Submit another query.