DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa40 and naa40

DIOPT Version :9

Sequence 1:NP_651715.1 Gene:Naa40 / 43500 FlyBaseID:FBgn0039687 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001120405.1 Gene:naa40 / 100145481 XenbaseID:XB-GENE-5846020 Length:236 Species:Xenopus tropicalis


Alignment Length:188 Identity:69/188 - (36%)
Similarity:105/188 - (55%) Gaps:5/188 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VETAARAKNPLESLSYQSYKAPSGEEFKLICRAKSDADSKLLKWAFKLAETNVGPYYKQLKMGWQ 80
            |:.|.:..:||.:.........:|....:.|...||.|.|.:.|||:|.:||:...|:|.:.||:
 Frog    29 VQAANQLGDPLSAFPVFKKFDRNGLNLSIECCKVSDLDQKTIDWAFELTKTNMQLLYEQSEWGWK 93

  Fly    81 PKIKAAELNKNWARYLVAQNEKKENVAYAMFRFDMDHGDCVLYCYEMQVAAEYRRKGLGKFIMST 145
            .:.|..||....|.||:|::|....||:..||||::.||.||||||:|:....||||:|||::..
 Frog    94 EREKREELTDERAWYLIARDELAAPVAFVHFRFDVECGDEVLYCYEVQLETHVRRKGVGKFLVQI 158

  Fly   146 LEDCARLWHLEKVMLTVLNNNEASISFFKQ-LGYVKDEISPDV----LEQADYQIFSK 198
            |:..|....::||:|||..:|..:..||:. |.:..||.||.|    .:...|:|.|:
 Frog   159 LQLMANSTQMKKVVLTVFKHNHGAYQFFRDALQFEIDETSPSVSGCCSDDCTYEILSR 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa40NP_651715.1 Acetyltransf_1 106..179 CDD:278980 33/73 (45%)
naa40NP_001120405.1 Acetyltransf_1 81..187 CDD:366181 43/105 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8767
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41588
Inparanoid 1 1.050 122 1.000 Inparanoid score I4603
OMA 1 1.010 - - QHG57159
OrthoDB 1 1.010 - - D1489686at2759
OrthoFinder 1 1.000 - - FOG0004357
OrthoInspector 1 1.000 - - oto103538
Panther 1 1.100 - - LDO PTHR20531
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1911
SonicParanoid 1 1.000 - - X4736
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.